NUP62 Antibody

Images

 
Western Blot: NUP62 Antibody [NBP1-85091] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NUP62 Antibody [NBP1-85091] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane.
Immunohistochemistry-Paraffin: NUP62 Antibody [NBP1-85091] - Staining of human cerebral cortex shows strong nuclear membrane and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUP62 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUP62
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUP62 Recombinant Protein Antigen (NBP1-85091PEP)
Publications
Read Publications using NBP1-85091.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUP62 Antibody

  • DKFZp547L134,62 kDa nucleoporin
  • FLJ20822
  • FLJ43869
  • IBSNp62
  • MGC841
  • nuclear pore glycoprotein p62
  • nucleoporin 62kD
  • nucleoporin 62kDa
  • SNDINucleoporin Nup62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00000420-B01P
Species: Hu
Applications: WB
NBL1-11392
Species: Hu
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUP62 Antibody (NBP1-85091)(2)

Reviews for NUP62 Antibody (NBP1-85091) (0)

There are no reviews for NUP62 Antibody (NBP1-85091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NUP62 Antibody (NBP1-85091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUP62 Products

Bioinformatics Tool for NUP62 Antibody (NBP1-85091)

Discover related pathways, diseases and genes to NUP62 Antibody (NBP1-85091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUP62 Antibody (NBP1-85091)

Discover more about diseases related to NUP62 Antibody (NBP1-85091).
 

Pathways for NUP62 Antibody (NBP1-85091)

View related products by pathway.

PTMs for NUP62 Antibody (NBP1-85091)

Learn more about PTMs related to NUP62 Antibody (NBP1-85091).

Blogs on NUP62

There are no specific blogs for NUP62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUP62 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP62
Entrez
Uniprot