NUP62 Antibody - BSA Free

Immunohistochemistry-Paraffin: NUP62 Antibody [NBP1-85091] - Analysis in human testis and liver tissues using NBP1-85091 antibody. Corresponding NUP62 RNA-seq data are presented for the same tissues.

Western Blot: NUP62 Antibody [NBP1-85091] - Analysis in human cell line HDLM-2.

Immunocytochemistry/Immunofluorescence: NUP62 Antibody [NBP1-85091] - Staining of human cell line U-2 OS shows localization to nuclear membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NUP62 Antibody [NBP1-85091] - Staining of human Skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: NUP62 Antibody [NBP1-85091] - Staining of human Cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: NUP62 Antibody [NBP1-85091] - Staining of human Liver shows very weak nuclear and cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: NUP62 Antibody [NBP1-85091] - Staining of human Testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUP62 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUP62 Antibody - BSA Free (NBP1-85091) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NUP62 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUP62
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NUP62 Recombinant Protein Antigen (NBP1-85091PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NUP62 Antibody - BSA Free

• DKFZp547L134,62 kDa nucleoporin
• FLJ20822
• FLJ43869
• IBSNp62
• MGC841
• nuclear pore glycoprotein p62
• nucleoporin 62kD
• nucleoporin 62kDa
• SNDINucleoporin Nup62

Background

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. Multiple transcript variants of this gene encode a single protein isoform. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUP62 Antibody (NBP1-85091)(2)

Publications using NBP1-85091

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]

Bioinformatics

• Gene Symbol: NUP62
• Entrez:
  • 23636(Human)
• Uniprot:
  • O95490()