NT5C Antibody

Western Blot: NT5C Antibody [NBP1-84564] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84564] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Western Blot: NT5C Antibody [NBP1-84564] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

• Reactivity: Hu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NT5C Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NT5C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NT5C Protein (NBP1-84564PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NT5C Antibody

• 3'-pyrimidine nucleotidase
• 5' nucleotidase, deoxy (pyrimidine), cytosolic type C
• 5', 3'-nucleotidase, cytosolic
• cdN
• Cytosolic 5'
• Deoxy-5'-nucleotidase 1
• dNT-15'(3')-deoxyribonucleotidase, cytosolic type
• DNT1DNT-1
• EC 3.1.3.-
• P5N2
• PN-I
• PN-II
• UMPH2DNT
• uridine 5'-monophosphate phosphohydrolase 2
• uridine 5-prime monophosphate hydrolase 2

Background

Pyrimidine 5-prime nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1; MIM 606224) and type II (UMPH2).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NT5C