NT5C Antibody


Western Blot: NT5C Antibody [NBP1-84564] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84564] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Western Blot: NT5C Antibody [NBP1-84564] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NT5C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NT5C Protein (NBP1-84564PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NT5C Antibody

  • 3'-pyrimidine nucleotidase
  • 5' nucleotidase, deoxy (pyrimidine), cytosolic type C
  • 5', 3'-nucleotidase, cytosolic
  • cdN
  • Cytosolic 5'
  • Deoxy-5'-nucleotidase 1
  • dNT-15'(3')-deoxyribonucleotidase, cytosolic type
  • DNT1DNT-1
  • EC 3.1.3.-
  • P5N2
  • PN-I
  • PN-II
  • uridine 5'-monophosphate phosphohydrolase 2
  • uridine 5-prime monophosphate hydrolase 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC, IHC-Fr, Flow-CS
Species: Hu, Mu, Rt, Ba, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for NT5C Antibody (NBP1-84564) (0)

There are no publications for NT5C Antibody (NBP1-84564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5C Antibody (NBP1-84564) (0)

There are no reviews for NT5C Antibody (NBP1-84564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NT5C Antibody (NBP1-84564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NT5C Products

Bioinformatics Tool for NT5C Antibody (NBP1-84564)

Discover related pathways, diseases and genes to NT5C Antibody (NBP1-84564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NT5C Antibody (NBP1-84564)

Discover more about diseases related to NT5C Antibody (NBP1-84564).

Pathways for NT5C Antibody (NBP1-84564)

View related products by pathway.

PTMs for NT5C Antibody (NBP1-84564)

Learn more about PTMs related to NT5C Antibody (NBP1-84564).

Blogs on NT5C

There are no specific blogs for NT5C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NT5C Antibody and receive a gift card or discount.


Gene Symbol NT5C