NT5C Antibody

Images

 
Western Blot: NT5C Antibody [NBP1-84564] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84564] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Western Blot: NT5C Antibody [NBP1-84564] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NT5C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NT5C Protein (NBP1-84564PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NT5C Antibody

  • 3'-pyrimidine nucleotidase
  • 5' nucleotidase, deoxy (pyrimidine), cytosolic type C
  • 5', 3'-nucleotidase, cytosolic
  • cdN
  • Cytosolic 5'
  • Deoxy-5'-nucleotidase 1
  • dNT-15'(3')-deoxyribonucleotidase, cytosolic type
  • DNT1DNT-1
  • EC 3.1.3.-
  • P5N2
  • PN-I
  • PN-II
  • UMPH2DNT
  • uridine 5'-monophosphate phosphohydrolase 2
  • uridine 5-prime monophosphate hydrolase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-92203
Species: Hu
Applications: WB, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32222
Species: Hu
Applications: WB, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
H00022978-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-84564
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NT5C Antibody (NBP1-84564) (0)

There are no publications for NT5C Antibody (NBP1-84564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5C Antibody (NBP1-84564) (0)

There are no reviews for NT5C Antibody (NBP1-84564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NT5C Antibody (NBP1-84564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NT5C Products

Bioinformatics Tool for NT5C Antibody (NBP1-84564)

Discover related pathways, diseases and genes to NT5C Antibody (NBP1-84564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NT5C Antibody (NBP1-84564)

Discover more about diseases related to NT5C Antibody (NBP1-84564).
 

Pathways for NT5C Antibody (NBP1-84564)

View related products by pathway.

PTMs for NT5C Antibody (NBP1-84564)

Learn more about PTMs related to NT5C Antibody (NBP1-84564).

Blogs on NT5C

There are no specific blogs for NT5C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT5C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5C