NPY1R Antibody

Western Blot: NPY1R Antibody [NBP1-59008] - Human Fetal Brain Lysate, concentration 1ug/ml.

Immunohistochemistry: NPY1R Antibody [NBP1-59008] - Analysis of mouse gut tissue.

Immunohistochemistry-Paraffin: NPY1R Antibody [NBP1-59008] - Human liver.

Immunohistochemistry-Paraffin: NPY1R Antibody [NBP1-59008] - Human Testis Tissue, 5ug/ml

Immunohistochemistry-Paraffin: NPY1R Antibody [NBP1-59008] - Human Gut Tissue, primary dilution 10ug/ml and 2ug/ml. Secondary goat anti-rabbit Cy3 at 1:500.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NPY1R Antibody Summary

• Immunogen: Synthetic peptides corresponding to NPY1R(neuropeptide Y receptor Y1) The peptide sequence was selected from the middle region of NPY1R. Peptide sequence TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPY1R
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against NPY1R and was validated on Western blot.
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NPY1R Antibody

• neuropeptide Y receptor type 1
• neuropeptide Y receptor Y1
• NPY1R
• NPY1-R
• NPYR
• NPYY1

Background

Neuropeptide Y (NPY) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle.Neuropeptide Y (NPY; MIM 162640) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle (Herzog et al., 1992 [PubMed 1321422]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NPY1R Antibody (NBP1-59008)(4)

Publications using NBP1-59008

• Gheller BJ, Blum JE, Merritt EK et al. Peptide YY (PYY) Is Expressed in Human Skeletal Muscle Tissue and Expanding Human Muscle Progenitor Cells Front Physiol 2019-03-05 [PMID: 30890955] (WB, Human)
• Gheller BJF Metabolic and Transcriptional Regulation of Muscle Stem Cell State Transition Thesis 2020-01-01
• Bhat R, Thangavel H, Abdulkareem NM et al. NPY1R exerts inhibitory action on estradiol-stimulated growth and predicts endocrine sensitivity and better survival in ER-positive breast cancer Scientific reports 2022-02-04 [PMID: 35121782] (WB, Human)
• Sun WW, ShangGuan T, Zhu P et al. Role of hepatic neuropeptide Y-Y1 receptors in a methionine-choline-deficient model of non-alcoholic steatohepatitis Life Sci 2020-01-29 [PMID: 31991181]

Bioinformatics

• Gene Symbol: NPY1R
• Uniprot:
  • P25929()