Cytochrome P450 2E1 Antibody

Images

 
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium shows no positivity in glandular or stromal cells as expected.
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver tissue.
Independent Antibodies: Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium, liver, liver cancer and tonsil using Anti-CYP2E1 antibody NBP1-85367 (A) shows ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver and endometrium tissues. Corresponding CYP2E1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver cancer shows moderate cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human tonsil shows no positivity in germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome P450 2E1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG
Specificity
Specificity of human Cytochrome P450 2E1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP2E1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
WB reported in scientific literature (PMID: 23126531). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publications using
NBP1-85367 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23126531)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytochrome P450 2E1 Antibody

  • 4-nitrophenol 2-hydroxylase
  • CPE1
  • CYP2Ecytochrome P450 2E1
  • CYPIIE1
  • cytochrome P450, family 2, subfamily E, polypeptide 1
  • cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1
  • Cytochrome P450-J
  • EC 1.14.13.-
  • EC 1.14.13.n7
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • microsomal monooxygenase
  • P450C2E
  • P450-J
  • xenobiotic monooxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67020
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29875
Species: Mu, Rt
Applications: WB
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88054
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Cytochrome P450 2E1 Antibody (NBP1-85367)(2)

We have publications tested in 1 confirmed species: Virus.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Virus
(1)
All Species

Reviews for Cytochrome P450 2E1 Antibody (NBP1-85367) (0)

There are no reviews for Cytochrome P450 2E1 Antibody (NBP1-85367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 2E1 Antibody (NBP1-85367) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cytochrome P450 2E1 Products

Bioinformatics Tool for Cytochrome P450 2E1 Antibody (NBP1-85367)

Discover related pathways, diseases and genes to Cytochrome P450 2E1 Antibody (NBP1-85367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 2E1 Antibody (NBP1-85367)

Discover more about diseases related to Cytochrome P450 2E1 Antibody (NBP1-85367).
 

Pathways for Cytochrome P450 2E1 Antibody (NBP1-85367)

View related products by pathway.

PTMs for Cytochrome P450 2E1 Antibody (NBP1-85367)

Learn more about PTMs related to Cytochrome P450 2E1 Antibody (NBP1-85367).
 

Research Areas for Cytochrome P450 2E1 Antibody (NBP1-85367)

Find related products by research area.

Blogs on Cytochrome P450 2E1

There are no specific blogs for Cytochrome P450 2E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 2E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2E1