NPAT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NPAT Antibody [NBP2-56922] - Staining of human cell line U-2 OS shows localization to nuclear bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPAT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL
Specificity
Specificity of human NPAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPAT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPAT Recombinant Protein Antigen (NBP2-56922PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NPAT Antibody

  • CAND3
  • E14
  • E14/NPAT
  • Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus
  • Nuclear Protein Of The ATM Locus
  • Nuclear Protein, Ataxia-Telangiectasia Locus
  • Nuclear Protein, Coactivator Of Histone Transcription
  • Nuclear Protein, Co-Activator Of Histone Transcription
  • p220
  • Protein NPAT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-32582
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4654
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-56922
Species: Hu
Applications: ICC/IF

Publications for NPAT Antibody (NBP2-56922) (0)

There are no publications for NPAT Antibody (NBP2-56922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAT Antibody (NBP2-56922) (0)

There are no reviews for NPAT Antibody (NBP2-56922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NPAT Antibody (NBP2-56922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NPAT Products

Array NBP2-56922

Bioinformatics Tool for NPAT Antibody (NBP2-56922)

Discover related pathways, diseases and genes to NPAT Antibody (NBP2-56922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPAT Antibody (NBP2-56922)

Discover more about diseases related to NPAT Antibody (NBP2-56922).
 

Pathways for NPAT Antibody (NBP2-56922)

View related products by pathway.

PTMs for NPAT Antibody (NBP2-56922)

Learn more about PTMs related to NPAT Antibody (NBP2-56922).

Blogs on NPAT

There are no specific blogs for NPAT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAT