Noggin Antibody

Western Blot: Noggin Antibody [H00009241-D01P] - Analysis of NOG expression in human liver.

Western Blot: Noggin Antibody [H00009241-D01P] - Analysis of NOG expression in Jurkat.

Western Blot: Noggin Antibody [H00009241-D01P] - Analysis of NOG expression in transfected 293T cell line by NOG polyclonal antibody.Lane 1: NOG transfected lysate(25.80 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

Noggin Antibody Summary

• Immunogen: NOG (NP_005441.1, 1 a.a. - 232 a.a.) full-length human protein. MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
• Specificity: Reacts with noggin.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOG
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Noggin Antibody

• NOG
• Noggin
• SYM1
• symphalangism 1 (proximal)
• synostoses (multiple) syndrome 1
• SYNS1
• SYNS1A

Background

The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients. The protein appears to have pleiotropic effect, both early in development as well as in later stages. It was originally isolated from Xenopus based on its ability to restore normal dorsal-ventral body axis in embryos that had been artificially ventralized by UV treatment. The results of the mouse knockout of the ortholog suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. Recently, several dominant human NOG mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) were identified; both SYM1 and SYNS1 have multiple joint fusion as their principal feature, and map to the same region (17q22) as this gene. All of these mutations altered evolutionarily conserved amino acid residues. The amino acid sequence of this human gene is highly homologous to that of Xenopus, rat and mouse. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOG
• Entrez:
  • 9241(Human)
• Uniprot:
  • NP_005441.1()