Noggin Antibody Summary
| Immunogen |
NOG (NP_005441.1, 1 a.a. - 232 a.a.) full-length human protein. MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
NOG |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Noggin Antibody
Background
The secreted polypeptide noggin (encoded by the Nog gene) binds and inactivates members of the transforming growth factor beta superfamily of signaling proteins (TGFbeta-FMs), such as BMP4. By diffusing through extracellular matrices more efficiently than TGFbeta-FMs, noggin may have a principal role in creating morphogenic gradients. Findings report that noggin is essential for joint formation and suggest that NOG requirements during skeletogenesis differ between species and between specific skeletal elements within species (1). Noggin is a bone morphogenetic protein (BMP) antagonist expressed in Spemann's organizer. Murine Noggin is expressed in condensing cartilage and immature chondrocytes, as are many BMPs (2). The structure of the antagonist Noggin bound to BMP-7, shows that noggin inhibits BMP signaling by blocking the molecular interfaces of the binding epitopes for both type I and type II receptors (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: Block, IHC
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Publications for Noggin Antibody (H00009241-B01P) (0)
There are no publications for Noggin Antibody (H00009241-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Noggin Antibody (H00009241-B01P) (0)
There are no reviews for Noggin Antibody (H00009241-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Noggin Antibody (H00009241-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Noggin Products
Research Areas for Noggin Antibody (H00009241-B01P)
Find related products by research area.
|
Blogs on Noggin