NOD2 Antibody - BSA Free

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Analysis in human skin and kidney tissues. Corresponding NOD2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human kidney shows no positivity in cells in tubules as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NOD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NOD2 Antibody - BSA Free (NBP2-48752) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NOD2 Recombinant Protein Antigen (NBP2-48752PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NOD2 Antibody - BSA Free

• BLAU
• CARD15caspase recruitment domain protein 15
• caspase recruitment domain family, member 15
• Caspase recruitment domain-containing protein 15
• CDACUG
• CLR16.3
• IBD1NLR family, CARD domain containing 2
• Inflammatory bowel disease protein 1
• NLRC2
• NOD-like receptor C2
• nucleotide-binding oligomerization domain 2
• nucleotide-binding oligomerization domain containing 2
• nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 2
• nucleotide-binding oligomerization domain-containing protein 2
• PSORAS1NOD2B

Background

NOD2 (nucleotide-binding oligomerization domain containing 2) is a member of the apoptosis regulating protein family that includes caspase recruitment-domains, as well as Apaf-1 and NOD1. It contains two N-terminal CARDs, a nucleotide binding domain (NBD), and multiple C-terminal leucine-rich repeats (LRRs). NOD2 is expressed in monocytes (whereas NOD1 is expressed in multiple tissues). NOD2 plays a role in regulating NF-kappaB. It also acts as an intracellular receptor for bacterial lipopolysaccharides and contributes to inflammatory bowel disease (IBD) and Crohn's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for NOD2 Antibody (NBP2-48752). (Showing 1 - 1 of 1 FAQ).

1. Can you suggest the best NOD2 antibody for detection of endogenous NOD2 in human fibroblasts?
   • For detecting endogenous NOD2 in human samples, I would recommend NB100-524. This antibody has been validated for use in WB, IHC-Paraffin and IP.

Bioinformatics

• Gene Symbol: NOD2