Recombinant Human NOD1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NOD1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 91-190 of Human NOD1

Source: Wheat Germ

Amino Acid Sequence: QQLADAYVDLRPWLLEIGFSPSLLTQSKVVVNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSLACLLDHTTGI

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NOD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NOD1 Protein

  • CARD4
  • CARD4NLR family, CARD domain containing 1
  • caspase recruitment domain family, member 4
  • Caspase recruitment domain-containing protein 4
  • CLR7.1
  • NLRC1
  • NOD1
  • nucleotide-binding oligomerization domain containing 1
  • nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1
  • nucleotide-binding oligomerization domain-containing protein 1

Background

CARD4 - caspase recruitment domain family, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP1-32424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IP, B/N, Flow-CS
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56148
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NB100-56142
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC

Publications for NOD1 Partial Recombinant Protein (H00010392-Q01) (0)

There are no publications for NOD1 Partial Recombinant Protein (H00010392-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOD1 Partial Recombinant Protein (H00010392-Q01) (0)

There are no reviews for NOD1 Partial Recombinant Protein (H00010392-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOD1 Partial Recombinant Protein (H00010392-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NOD1 Partial Recombinant Protein (H00010392-Q01)

Discover related pathways, diseases and genes to NOD1 Partial Recombinant Protein (H00010392-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOD1 Partial Recombinant Protein (H00010392-Q01)

Discover more about diseases related to NOD1 Partial Recombinant Protein (H00010392-Q01).
 

Pathways for NOD1 Partial Recombinant Protein (H00010392-Q01)

View related products by pathway.

PTMs for NOD1 Partial Recombinant Protein (H00010392-Q01)

Learn more about PTMs related to NOD1 Partial Recombinant Protein (H00010392-Q01).
 

Research Areas for NOD1 Partial Recombinant Protein (H00010392-Q01)

Find related products by research area.

Blogs on NOD1.

cIAP2 - balancing cell death and cell survival
The inhibitor of apoptosis proteins (IAPs) are important regulators of cell death and inflammation. The cellular inhibitor of apoptosis protein 2 (cIAP2) contains three Baculovirus IAP repeat (BIR) domains, a Ubiquitin associated (UBA) domain, and...  Read full blog post.

Customers Who Bought This Also Bought

NOD1 Antibody
NB100-56152
IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NOD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOD1
Entrez