NMT1 Antibody

Images

 
Western Blot: NMT1 Antibody [NBP1-82547] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-389
Immunocytochemistry/ Immunofluorescence: NMT1 Antibody [NBP1-82547] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cytoskeleton (actin filaments).
Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in the molecular layer.
Western Blot: NMT1 Antibody [NBP1-82547] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

NMT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
NMT1 Protein (NBP1-82547PEP)
Publications
Read Publication using
NBP1-82547 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25255805).

Alternate Names for NMT1 Antibody

  • alternative, short form NMT-S
  • glycylpeptide N-tetradecanoyltransferase 1
  • long form, NMT-L
  • Myristoyl-CoA:protein N-myristoyltransferase 1
  • NMT 1
  • NMTEC 2.3.1.97
  • N-myristoyltransferase 1
  • Peptide N-myristoyltransferase 1
  • Type I N-myristoyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01676
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
MAB2685
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-81838
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-59580
Species: Hu, Rt
Applications: WB

Publications for NMT1 Antibody (NBP1-82547)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NMT1 Antibody (NBP1-82547) (0)

There are no reviews for NMT1 Antibody (NBP1-82547). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NMT1 Antibody (NBP1-82547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMT1 Antibody Products

Related Products by Gene

Bioinformatics Tool for NMT1 Antibody (NBP1-82547)

Discover related pathways, diseases and genes to NMT1 Antibody (NBP1-82547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMT1 Antibody (NBP1-82547)

Discover more about diseases related to NMT1 Antibody (NBP1-82547).
 

Pathways for NMT1 Antibody (NBP1-82547)

View related products by pathway.

PTMs for NMT1 Antibody (NBP1-82547)

Learn more about PTMs related to NMT1 Antibody (NBP1-82547).

Blogs on NMT1

There are no specific blogs for NMT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our NMT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMT1

Customers Who Bought This Also Bought