NMT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding NMT1 RNA-seq data are presented for the same tissues.

Western Blot: NMT1 Antibody [NBP1-82547] - Analysis using Anti-NMT1 antibody NBP1-82547 (A) shows similar pattern to independent antibody NBP1-82548 (B).

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.

Western Blot: NMT1 Antibody [NBP1-82547] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Western Blot: NMT1 Antibody [NBP1-82547] - Analysis in human cell line HDLM-2.

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells and basket cells.

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NMT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NMT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NMT1 Protein (NBP1-82547PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NMT1 Antibody - BSA Free

• alternative, short form NMT-S
• glycylpeptide N-tetradecanoyltransferase 1
• long form, NMT-L
• Myristoyl-CoA:protein N-myristoyltransferase 1
• NMT 1
• NMTEC 2.3.1.97
• N-myristoyltransferase 1
• Peptide N-myristoyltransferase 1
• Type I N-myristoyltransferase

Background

Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1; MIM 139311) (Duronio et al., 1992 (PubMed 1570339)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NMT1 Antibody (NBP1-82547)(1)

Publication using NBP1-82547

• Thinon E, Serwa RA, Broncel M et al. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nat Commun 2014-09-26 [PMID: 25255805] (WB, Human)

Bioinformatics

• Gene Symbol: NMT1