NMT1 Antibody

Images

 
Western Blot: NMT1 Antibody [NBP1-82547] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: NMT1 Antibody [NBP1-82547] - Staining of human cell line U-2 OS shows positivity in cytoplasm & cytoskeleton (actin filaments).
Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in the molecular layer.
Western Blot: NMT1 Antibody [NBP1-82547] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).

Product Details

Summary
Reactivity Hu, Mu, Rt, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

NMT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
NMT1 Protein (NBP1-82547PEP)
Publications
Read Publication using
NBP1-82547 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25255805).

Alternate Names for NMT1 Antibody

  • alternative, short form NMT-S
  • glycylpeptide N-tetradecanoyltransferase 1
  • long form, NMT-L
  • Myristoyl-CoA:protein N-myristoyltransferase 1
  • NMT 1
  • NMTEC 2.3.1.97
  • N-myristoyltransferase 1
  • Peptide N-myristoyltransferase 1
  • Type I N-myristoyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01676
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
MAB2685
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP1-82547
Species: Hu, Mu, Rt, Mouse, Rat
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NMT1 Antibody (NBP1-82547)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NMT1 Antibody (NBP1-82547) (0)

There are no reviews for NMT1 Antibody (NBP1-82547). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NMT1 Antibody (NBP1-82547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMT1 Antibody Products

Related Products by Gene

Bioinformatics Tool for NMT1 Antibody (NBP1-82547)

Discover related pathways, diseases and genes to NMT1 Antibody (NBP1-82547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMT1 Antibody (NBP1-82547)

Discover more about diseases related to NMT1 Antibody (NBP1-82547).
 

Pathways for NMT1 Antibody (NBP1-82547)

View related products by pathway.

PTMs for NMT1 Antibody (NBP1-82547)

Learn more about PTMs related to NMT1 Antibody (NBP1-82547).

Blogs on NMT1

There are no specific blogs for NMT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NMT1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-82547 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought