Calpain 2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CAPN2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Calpain 2 Antibody
Background
The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammaliancalpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist ofheterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This geneencodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites inthe 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene.(provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, PLA, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for Calpain 2 Antibody (NBP1-88204) (0)
There are no publications for Calpain 2 Antibody (NBP1-88204).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calpain 2 Antibody (NBP1-88204) (0)
There are no reviews for Calpain 2 Antibody (NBP1-88204).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Calpain 2 Antibody (NBP1-88204) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Calpain 2 Products
Bioinformatics Tool for Calpain 2 Antibody (NBP1-88204)
Discover related pathways, diseases and genes to Calpain 2 Antibody (NBP1-88204). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Calpain 2 Antibody (NBP1-88204)
Discover more about diseases related to Calpain 2 Antibody (NBP1-88204).
| | Pathways for Calpain 2 Antibody (NBP1-88204)
View related products by pathway.
|
PTMs for Calpain 2 Antibody (NBP1-88204)
Learn more about PTMs related to Calpain 2 Antibody (NBP1-88204).
| | Research Areas for Calpain 2 Antibody (NBP1-88204)
Find related products by research area.
|
Blogs on Calpain 2