NMES1 Antibody

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NMES1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C15ORF48
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NMES1 Antibody

• C15orf48
• chromosome 15 open reading frame 48
• FLJ22645
• FOAP-11
• MGC32925
• NMES1
• NMES1normal mucosa of esophagus specific 1
• normal mucosa of esophagus-specific gene 1 protein
• Protein FOAP-11

Background

C15orf48 was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified. Transcript Variant: This variant (2) contains an additional segment of 5' UTR sequence when compared to variant 1. Both variants 1 and 2 encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C15ORF48
• Uniprot:
  • Q9C002(Human)