AADAC Antibody (2E8)

Images

 
ELISA: AADAC Antibody (2E8) [H00000013-M01] - AADAC Antibody (2E8) [H00000013-M01] - Detection limit for recombinant GST tagged AADAC is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, Rt, PmSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AADAC Antibody (2E8) Summary

Immunogen
AADAC (NP_001077, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP
Specificity
arylacetamide deacetylase (esterase)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AADAC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00000013-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AADAC Antibody (2E8)

  • arylacetamide deacetylase (esterase)
  • arylacetamide deacetylase
  • CES5A1
  • DACEC 3.1.1.3
  • EC 3.1.1
  • EC 3.1.1.79

Background

Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14013
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC, IHC-P
NB100-41398
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NBP1-84556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000013-M01
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, S-ELISA

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AADAC Antibody (H00000013-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AADAC Products

Bioinformatics Tool for AADAC Antibody (H00000013-M01)

Discover related pathways, diseases and genes to AADAC Antibody (H00000013-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AADAC Antibody (H00000013-M01)

Discover more about diseases related to AADAC Antibody (H00000013-M01).
 

Pathways for AADAC Antibody (H00000013-M01)

View related products by pathway.

PTMs for AADAC Antibody (H00000013-M01)

Learn more about PTMs related to AADAC Antibody (H00000013-M01).

Blogs on AADAC

There are no specific blogs for AADAC, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AADAC Antibody (2E8) and receive a gift card or discount.

Bioinformatics

Gene Symbol AADAC
Entrez
OMIM
Uniprot