SHFM3 Antibody

Western Blot: SHFM3 Antibody [NBP2-14013] - Analysis in human cell line MCF-7.

Immunocytochemistry/Immunofluorescence: SHFM3 Antibody [NBP2-14013] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human lymphoid tissue shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human colon shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human pancreas shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SHFM3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD
• Predicted Species: Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXW4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SHFM3 Protein (NBP2-14013PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SHFM3 Antibody

• DAC
• dactylin
• F-box and WD repeat domain containing 4
• F-box and WD-40 domain protein 4
• F-box and WD-40 domain-containing protein 4
• F-box/WD repeat protein 4
• F-box/WD repeat-containing protein 4
• Fbw4
• FBW4split hand/foot malformation (ectrodactyly) type 3
• FBWD4
• SHFM3
• SHSF3

Background

SHFM3 is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXW4