SHFM3 Antibody

Images

 
Western Blot: SHFM3 Antibody [NBP2-14013] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: SHFM3 Antibody [NBP2-14013] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human lymphoid tissue shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human colon shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human pancreas shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHFM3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXW4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHFM3 Protein (NBP2-14013PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHFM3 Antibody

  • DAC
  • dactylin
  • F-box and WD repeat domain containing 4
  • F-box and WD-40 domain protein 4
  • F-box and WD-40 domain-containing protein 4
  • F-box/WD repeat protein 4
  • F-box/WD repeat-containing protein 4
  • Fbw4
  • FBW4split hand/foot malformation (ectrodactyly) type 3
  • FBWD4
  • SHFM3
  • SHSF3

Background

SHFM3 is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1916
Species: Hu
Applications: ICC, IHC, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
423-F8
Species: Hu, Mu
Applications: BA
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-27192
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: IHC, IHC-P, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-91148
Species: Hu
Applications: IHC, IHC-P
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
D6050
Species: Hu
Applications: ELISA
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB

Publications for SHFM3 Antibody (NBP2-14013) (0)

There are no publications for SHFM3 Antibody (NBP2-14013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHFM3 Antibody (NBP2-14013) (0)

There are no reviews for SHFM3 Antibody (NBP2-14013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHFM3 Antibody (NBP2-14013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHFM3 Products

Bioinformatics Tool for SHFM3 Antibody (NBP2-14013)

Discover related pathways, diseases and genes to SHFM3 Antibody (NBP2-14013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHFM3 Antibody (NBP2-14013)

Discover more about diseases related to SHFM3 Antibody (NBP2-14013).
 

Pathways for SHFM3 Antibody (NBP2-14013)

View related products by pathway.

PTMs for SHFM3 Antibody (NBP2-14013)

Learn more about PTMs related to SHFM3 Antibody (NBP2-14013).
 

Research Areas for SHFM3 Antibody (NBP2-14013)

Find related products by research area.

Blogs on SHFM3

There are no specific blogs for SHFM3, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHFM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW4