NMES1 Antibody

Images

 
Western Blot: NMES1 Antibody [NBP1-98391] - Host: Rabbit. Target Name: C15orf48. Sample Tissue: Human PANC1 Whole Cell. Antibody at 1 ug/mL.
Flow Cytometry: NMES1 Antibody [NBP1-98391] - Anti-NMES1 antibody at 1:500 dilution. Cells were labeled with a FITC-conjugated secondary antibody. Top: unstained; grey; and NMES1-labeled; blue; cells. Bottom: NMES1 ...read more
Western Blot: NMES1 Antibody [NBP1-98391] - PANC1 Cell Lysate. Antiboyd at 1.0 ug/mL, Gel Concentration: 10-20%.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NMES1 Antibody Summary

Immunogen
The immunogen for this antibody is C15orf48 - N-terminal region. Peptide sequence VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C15ORF48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Western Blot 1.0 ug/ml
Application Notes
This NMES1 antibody is validated for Flow cytometry from a verified customer review.
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-98391 in the following applications:

Publications
Read Publication using
NBP1-98391 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NMES1 Antibody

  • C15orf48
  • chromosome 15 open reading frame 48
  • FLJ22645
  • FOAP-11
  • MGC32925
  • NMES1
  • NMES1normal mucosa of esophagus specific 1
  • normal mucosa of esophagus-specific gene 1 protein
  • Protein FOAP-11

Background

This gene was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1080
Species: Hu
Applications: IHC, IP, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF5510
Species: Hu
Applications: WB
H00000013-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
DIP100
Species: Hu
Applications: ELISA
NBP2-14013
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3825
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF1476
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
DY281
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-14870
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45788
Species: Ce, Hu
Applications: IHC, IHC-P, WB
MAB8550
Species: Hu
Applications: CyTOF-ready, Flow, ICC, KO, WB
NBP1-87512
Species: Hu
Applications: IHC, IHC-P
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for NMES1 Antibody (NBP1-98391)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for NMES1 Antibody (NBP1-98391) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-98391:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry NMES1 NBP1-98391
Enlarge
5
reviewed by:
David Donley
Flow Mouse 07/17/2020
View

Summary

ApplicationFlow Cytometry
Sample TestedCell culture
SpeciesMouse
LotQC29456-43259

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMES1 Antibody (NBP1-98391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMES1 Products

Array NBP1-98391

Bioinformatics Tool for NMES1 Antibody (NBP1-98391)

Discover related pathways, diseases and genes to NMES1 Antibody (NBP1-98391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NMES1

There are no specific blogs for NMES1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

David Donley
07/17/2020
Application: Flow
Species: Mouse

Bioinformatics

Gene Symbol C15ORF48
Uniprot