NMES1 Antibody - BSA Free

Western Blot: NMES1 Antibody [NBP1-98391] - Host: Rabbit. Target Name: C15orf48. Sample Tissue: Human PANC1 Whole Cell. Antibody at 1 ug/mL.

Flow Cytometry: NMES1 Antibody [NBP1-98391] - Anti-NMES1 antibody at 1:500 dilution. Cells were labeled with a FITC-conjugated secondary antibody. Top: unstained; grey; and NMES1-labeled; blue; cells. Bottom: NMES1 fluorescence with no primary antibody added; dotted line; and labeled; solid line; cells. Flow cytometry image submitted by a verified customer review.

Western Blot: NMES1 Antibody [NBP1-98391] - PANC1 Cell Lysate. Antiboyd at 1.0 ug/mL, Gel Concentration: 10-20%.

• Reactivity: Hu, Mu
• Applications: WB, Flow
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NMES1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is C15orf48 - N-terminal region. Peptide sequence VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C15ORF48
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Western Blot 1.0 ug/ml
• Application Notes: This NMES1 antibody is validated for Flow cytometry from a verified customer review.
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NMES1 Antibody - BSA Free

• C15orf48
• chromosome 15 open reading frame 48
• FLJ22645
• FOAP-11
• MGC32925
• NMES1
• NMES1normal mucosa of esophagus specific 1
• normal mucosa of esophagus-specific gene 1 protein
• Protein FOAP-11

Background

This gene was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NMES1 Antibody (NBP1-98391)(3)

Publications using NBP1-98391

• Li C, Tang Y, Li Q et al. The prognostic and immune significance of C15orf48 in pan-cancer and its relationship with proliferation and apoptosis of thyroid carcinoma Frontiers in immunology 2023-03-09 [PMID: 36969231] (WB, Human)
• Takakura Y, Machida M, Terada N et al. Mitochondrial protein C15ORF48 is a stress-independent inducer of autophagy that regulates oxidative stress and autoimmunity bioRxiv 2023-10-20 (Flow Cytometry, Mouse)
• Lee CQE, Kerouanton B, Chothani S et al. Coding and non-coding roles of MOCCI (C15ORF48) coordinate to regulate host inflammation and immunity Nature communications 2021-04-09 [PMID: 33837217] (WB, Mouse)

Review for NMES1 Antibody (NBP1-98391) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: David Donley Flow Mouse 07/17/2020

Summary

• Application: Flow Cytometry
• Sample Tested: Cell culture
• Species: Mouse
• Lot: QC29456-43259

Bioinformatics

• Gene Symbol: C15ORF48
• Uniprot:
  • NP_115789(Human)