Home » NMES1 » NMES1 Antibodies » NMES1 Antibody

NMES1 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NMES1 Antibody [NBP1-98391] - Host: Rabbit. Target Name: C15orf48. Sample Tissue: Human PANC1 Whole Cell. Antibody at 1 ug/mL.
Western Blot: NMES1 Antibody [NBP1-98391] - Host: Rabbit. Target Name: C15orf48. Sample Tissue: Human PANC1 Whole Cell. Antibody at 1 ug/mL.
Flow Cytometry: NMES1 Antibody [NBP1-98391] - Anti-NMES1 antibody at 1:500 dilution. Cells were labeled with a FITC-conjugated secondary antibody. Top: unstained; grey; and NMES1-labeled; blue; cells. Bottom: NMES1 ...read more
Western Blot: NMES1 Antibody [NBP1-98391] - PANC1 Cell Lysate. Antiboyd at 1.0 ug/mL, Gel Concentration: 10-20%.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NMES1 Antibody Summary

Immunogen
The immunogen for this antibody is C15orf48 - N-terminal region. Peptide sequence VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C15ORF48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Western Blot 1.0 ug/ml
Application Notes
This NMES1 antibody is validated for Flow cytometry from a verified customer review.
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-98391 in the following applications:
Publications
Read Publication using
NBP1-98391 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NMES1 Antibody

  • C15orf48
  • chromosome 15 open reading frame 48
  • FLJ22645
  • FOAP-11
  • MGC32925
  • NMES1
  • NMES1normal mucosa of esophagus specific 1
  • normal mucosa of esophagus-specific gene 1 protein
  • Protein FOAP-11

Background

This gene was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cathepsin V
Antibody (182016) [Un ...
MAB1080
Cathepsin V Antibody (182016) [Unconjugated]
(5 Publications)
Species: Hu
Applications: IHC, IP, WB
Cathepsin L
Antibody [Unconjugate
AF952
Western blot shows 10 ng of Recombinant Human Cathepsin L (Catalog # 952-CY), Recombinant Mouse Cathepsin L (Catalog # 1515-CY), Recombinant Human Cathepsin V (Catalog # 1080-CY), Recombinant Human Cathepsin K, Recombinant Human Cathepsin S (Catalog # 1183-CY), Recombinant Human Cathepsin H (Catalog # 7516-CY), and Recombinant Human Cathepsin F. PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human Cathepsin L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF952) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Cathepsin L at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Cathepsin L was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human Cathepsin L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF952) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
GADD45 alpha
Antibody
AF5510
Western blot shows lysates of 293T human embryonic kidney cell line either mock transfected or transfected with full length human GADD45 alpha . PVDF membrane was probed with 1 µg/mL Human GADD45 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5510) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band for GADD45 alpha was detected at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
AADAC Antibody
(2E8)
H00000013-M01
ELISA: AADAC Antibody (2E8) [H00000013-M01] - AADAC Antibody (2E8) [H00000013-M01] - Detection limit for recombinant GST tagged AADAC is approximately 3ng/ml as a capture antibody.
(5 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Immunofluorescent staining of TMAs. Representative tissue cores from normal (I), adenomatous polyps (II), and CRC (III and IV) are shown. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(117 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
CXCL10/IP-10/CRG-2
[HRP]
DIP100
(10 Reviews)
(120 Publications)
Species: Hu
Applications: ELISA
SHFM3 Antibody
NBP2-14013
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Immunocytochemistry/Immunofluorescence: SHFM3 Antibody [NBP2-14013] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Western Blot: SHFM3 Antibody [NBP2-14013] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Stabilin-1 Antibody
AF3825
Human whole blood CD14+ monocytes were stained with Sheep Anti-Human Stabilin‑1 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3825, filled histogram) or isotype control antibody (Catalog # 5-001-A, open histogram), followed by Northern­Lights™ 637-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL011).
Species: Hu
Applications: CyTOF-ready, Flow, WB
FABP5/E-FABP
Antibody [Unconjugate
AF1476
Western blot shows lysates of human placenta tissue, mouse liver tissue, rat brain tissue, and rat heart tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat FABP5/E‑FABP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1476) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for FABP5/E‑FABP at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and FABP5/E‑FABP knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat FABP5/E‑FABP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1476) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for FABP5/E‑FABP at approximately 15 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
FABP5/E‑FABP was detected in immersion fixed paraffin-embedded sections of mouse skin (ear) tissue using Goat Anti-Human/Mouse/Rat FABP5/E‑FABP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1476) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell nuclei. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
CCL8/MCP-2 [Biotin]
DY281
(10 Publications)
Species: Hu
Applications: ELISA
CCL2/JE/MCP-1 [HRP]
DCP00
(8 Reviews)
(215 Publications)
Species: Hu
Applications: ELISA
SPARC Antibody
[Unconjugated]
AF942
Western blot shows lysates of C2C12 mouse myoblast cell line and mouse placenta tissue. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse SPARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SPARC at approximately 35-37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SPARC/Osteonectin was detected in immersion fixed frozen sections of mouse embryo (E15) using Mouse SPARC/Osteonectin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing cartilage. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
SPARC was detected in immersion fixed C2C12 mouse myoblast cell line using Goat Anti-Mouse SPARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to endoplasmic reticuli. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(20 Publications)
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Doublecortin
Antibody
NBP1-72042
Western Blot: Doublecortin Antibody [NBP1-72042] - staining of Mouse fetal Brain lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (5 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL).
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed KNRK cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Alpha-TTP Antibody
NBP2-14870
Immunohistochemistry-Paraffin: Alpha-TTP Antibody [NBP2-14870] - Gastric cancer. alpha TTP antibody [C2C3], C-term dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Alpha-TTP Antibody [NBP2-14870] - Rat tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with alpha TTP antibody [C2C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Alpha-TTP Antibody [NBP2-14870] - Mouse tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with alpha TTP antibody [C2C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Serpin B3/SCCA1
Antibody (OTI1A12)
NBP2-45788
Immunohistochemistry: Serpin B3/SCCA1 Antibody (1A12) [NBP2-45788] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Serpin B3/SCCA1 Antibody (1A12) [NBP2-45788] - Analysis of Carcinoma of Human lung tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Serpin B3/SCCA1 Antibody (1A12) [NBP2-45788] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(1 Publication)
Species: Ce, Hu
Applications: IHC, IHC-P, WB
SerpinB2 Antibody
(930109) [Unconjugate ...
MAB8550
Serpin B2 was detected in immersion fixed K562 human chronic myelogenous leukemia cell line treated with PMA but is not detected in Serpin B2 knockout (KO) K562 cell line using Mouse Anti-Human Serpin B2 Monoclonal Antibody (Catalog # MAB8550) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Serpin B2 was detected in immersion fixed U937 human histiocytic lymphoma cell line stimulated with PMA using Mouse Anti-Human Serpin B2 Monoclonal Antibody (Catalog # MAB8550) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of U937 human histiocytic lymphoma cell line untreated (-) or treated (+) with PMA and HEK001 human epidermal keratinocyte cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human Serpin B2 Monoclonal Antibody (Catalog # MAB8550) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Serpin B2 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, KO, WB
SPPL2a Antibody
NBP1-87512
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Analysis in human parathyroid gland and cerebral cortex tissues. Corresponding SPPL2A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human cerebral cortex shows weak positivity.
Species: Hu
Applications: IHC, IHC-P
ACD Antibody
(1D8-1B6)
H00065057-M02
Western Blot: ACD Antibody (1D8-1B6) [H00065057-M02] - Western Blot analysis of ACD expression in IMR-32 ( Cat # L008V1 ).
Immunocytochemistry/Immunofluorescence: ACD Antibody (1D8-1B6) [H00065057-M02] - Analysis of monoclonal antibody to ACD on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ACD Antibody (1D8-1B6) [H00065057-M02] - Analysis of monoclonal antibody to ACD on formalin-fixed paraffin-embedded human heart tissue. Antibody concentration 2 ug/ml.
(1 Review)
(8 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for NMES1 Antibody (NBP1-98391)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for NMES1 Antibody (NBP1-98391) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-98391:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry NMES1 NBP1-98391
Enlarge 		5
reviewed by:
David Donley
 Flow Mouse 07/17/2020
View

Summary

ApplicationFlow Cytometry
Sample TestedCell culture
SpeciesMouse
LotQC29456-43259

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMES1 Antibody (NBP1-98391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMES1 Products

Array NBP1-98391

Bioinformatics Tool for NMES1 Antibody (NBP1-98391)

Discover related pathways, diseases and genes to NMES1 Antibody (NBP1-98391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NMES1

There are no specific blogs for NMES1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Flow Cytometry NMES1 NBP1-98391
Enlarge
 David Donley
07/17/2020
Application: Flow
Species: Mouse
read this review

Bioinformatics

Gene Symbol C15ORF48
Uniprot