NMDAR1 Antibody (1H1T3) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NMDAR1 (Q05586). SRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
GRIN1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NMDAR1 Antibody (1H1T3)
Background
N-methyl-D-aspartate (NMDA) receptors are ligand-gated ion channels that have a high permeability to calcium found in the central nervous system. The receptor consists of a number of distinct ligand binding domains, and the presence of both glutamate and glycine are required for full activation of the channel. Within the channel there is also a binding site for magnesium, which, when occupied, propagates a voltage-dependent channel block. Other binding sites are also found in the receptor, including a zinc-binding site and an inter-channel site that binds specific channel blockers such as phencyclidine (PCP) and related compounds. The NMDA receptor has been demonstrated to play an essential role in long-term potentiation (LTP), a phenomenon that has been implicated to be the basis for learning and memory. The influx of calcium as a result of channel activation is thought to be responsible for neuronal plasticity and glutamate neurotoxicity. A number of different NMDA receptor subunits have been cloned that may possess different functional and localization properties. The NMDA-R1 subunit (NR1) is expressed throughout the brain, while the NMDA-R2 subunits (NR2A, NR2B, NR2C, and NR2D) have a more specific localization pattern. The NMDA receptor subunits differ also in glycine sensitivity, the relative strength of the magnesium channel block, and their respective agonist-dependent deactivation time.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: IHC, IHC-P, WB
Publications for NMDAR1 Antibody (NBP3-15431) (0)
There are no publications for NMDAR1 Antibody (NBP3-15431).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NMDAR1 Antibody (NBP3-15431) (0)
There are no reviews for NMDAR1 Antibody (NBP3-15431).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NMDAR1 Antibody (NBP3-15431) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NMDAR1 Products
Research Areas for NMDAR1 Antibody (NBP3-15431)
Find related products by research area.
|
Blogs on NMDAR1