NM23-H1 Antibody - Azide and BSA Free

Western Blot: NM23-H1 Antibody [NBP3-03013] - Analysis of extracts from normal (control) and NME1 knockout (KO) 293T cells, using NM23-H1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NM23-H1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit NM23-H1 Antibody - Azide and BSA Free (NBP3-03013) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 10-110 of human NM23-H1 (NP_000260.1). AIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NME1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Knockout Validated
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NM23-H1 Antibody - Azide and BSA Free

• EC 2.7.4.6
• GAAD
• Granzyme A-activated DNase
• Metastasis inhibition factor nm23
• NB
• NBS
• NDK A
• NDKA
• NDP kinase A
• NDPKA
• NDPK-A
• NM23A
• NM23AWD
• NM23H1
• NM23-H1
• NME1
• non-metastatic cells 1, protein (NM23A) expressed in
• nucleoside diphosphate kinase A
• Tumor metastatic process-associated protein

Background

The nm23 gene, a potential suppressor of metastasis, was originally identified by differential hybridization between two murine melanoma sub-lines, one with a high and the second with a low metastatic capacity. Highly metastatic sub-lines exhibit much lower levels of nm23 than less metastatic cells. Based on sequence analysis, nm23 appears highly related to nucleotide diphosphate kinases (NDP). In humans, NDP kinases A and B are identical to two isotypes of human nm23 homologs, namely nm23-H1 and -H2, respectively. nm23-H2 is identical in sequence to PuF, a transcription factor that binds to nucleasehypersensitive elements at positions 142 to 115 of the human c-Myc promotor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NME1