NLRP5 Antibody

Images

 
Western Blot: NLRP5 Antibody [NBP1-69159] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLRP5 Antibody Summary

Immunogen
Synthetic peptides corresponding to NLRP5 (NLR family, pyrin domain containing 5) The peptide sequence was selected from the N terminal of NLRP5. Peptide sequence LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NLRP5 and was validated on Western blot.
Theoretical MW
134 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NLRP5 Antibody

  • CLR19.8
  • MATERMater protein homolog
  • NACHT, leucine rich repeat and PYD containing 5
  • NACHT, LRR and PYD domains-containing protein 5
  • NALP5maternal antigen that embryos require
  • NLR family, pyrin domain containing 5
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 5
  • PAN11
  • PYPAF8

Background

The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-611
Species: Hu
Applications: WB, IP
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69159
Species: Hu
Applications: WB

Publications for NLRP5 Antibody (NBP1-69159) (0)

There are no publications for NLRP5 Antibody (NBP1-69159).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP5 Antibody (NBP1-69159) (0)

There are no reviews for NLRP5 Antibody (NBP1-69159). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NLRP5 Antibody (NBP1-69159) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NLRP5 Products

Bioinformatics Tool for NLRP5 Antibody (NBP1-69159)

Discover related pathways, diseases and genes to NLRP5 Antibody (NBP1-69159). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP5 Antibody (NBP1-69159)

Discover more about diseases related to NLRP5 Antibody (NBP1-69159).
 

Pathways for NLRP5 Antibody (NBP1-69159)

View related products by pathway.

PTMs for NLRP5 Antibody (NBP1-69159)

Learn more about PTMs related to NLRP5 Antibody (NBP1-69159).
 

Research Areas for NLRP5 Antibody (NBP1-69159)

Find related products by research area.

Blogs on NLRP5

There are no specific blogs for NLRP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP5
Uniprot