NKX3-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NKX3-2 Antibody [NBP1-88708] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry: NKX3-2 Antibody [NBP1-88708] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKX3-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NKX3-2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NKX3-2 Protein (NBP1-88708PEP)
Publications
Read Publication using NBP1-88708.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKX3-2 Antibody

  • Bagpipe homeobox protein homolog 1
  • BAPX1bagpipe homeobox homolog 1 (Drosophila)
  • Homeobox protein NK-3 homolog B
  • homeobox protein Nkx-3.2
  • MGC138171
  • NK3 homeobox 2
  • NKX3.2
  • NKX3BSMMD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1828
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
423-F8/CF
Species: Hu, Mu
NBP1-88637
Species: Hu
Applications: WB, IHC, IHC-P
AF853
Species: Mu
Applications: WB, IHC
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP1-89481
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-04309
Species: Hu
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for NKX3-2 Antibody (NBP1-88708)(1)

Reviews for NKX3-2 Antibody (NBP1-88708) (0)

There are no reviews for NKX3-2 Antibody (NBP1-88708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NKX3-2 Antibody (NBP1-88708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKX3-2 Products

Bioinformatics Tool for NKX3-2 Antibody (NBP1-88708)

Discover related pathways, diseases and genes to NKX3-2 Antibody (NBP1-88708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX3-2 Antibody (NBP1-88708)

Discover more about diseases related to NKX3-2 Antibody (NBP1-88708).
 

Pathways for NKX3-2 Antibody (NBP1-88708)

View related products by pathway.

PTMs for NKX3-2 Antibody (NBP1-88708)

Learn more about PTMs related to NKX3-2 Antibody (NBP1-88708).

Blogs on NKX3-2

There are no specific blogs for NKX3-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKX3-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX3-2