NKIRAS2 Antibody - BSA Free

Western Blot: NKIRAS2 Antibody [NBP1-58926] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NKIRAS2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NKIRAS2(NFKB inhibitor interacting Ras-like 2) The peptide sequence was selected from the C terminal of NKIRAS2. Peptide sequence VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKIRAS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NKIRAS2 Antibody - BSA Free

• DKFZP434N1526
• I-kappa-B-interacting Ras-like protein 2
• Kappa B-Ras protein 2
• kappaB-Ras2
• KBRAS2DKFZp434N1526
• MGC74742
• NF-kappa-B inhibitor-interacting Ras-like protein 2
• NFKB inhibitor interacting Ras-like 2
• NFKB inhibitor interacting Ras-like protein 2

Background

NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKIRAS2
• Uniprot:
  • Q9NYR9(Human)