NIT2 Antibody

Images

 
Western Blot: NIT2 Antibody [NBP1-89486] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: NIT2 Antibody [NBP1-89486] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: NIT2 Antibody [NBP1-89486] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: NIT2 Antibody [NBP1-89486] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: NIT2 Antibody [NBP1-89486] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NIT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NIT2 Protein (NBP1-89486PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NIT2 Antibody

  • EC 3.5.1.3
  • MGC111199
  • Nit protein 2
  • nitrilase family, member 2
  • Nitrilase homolog 2
  • omega-amidase NIT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02462
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF6144
Species: Hu
Applications: WB, Simple Western
H00055821-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56943
Species: Hu
Applications: ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for NIT2 Antibody (NBP1-89486) (0)

There are no publications for NIT2 Antibody (NBP1-89486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIT2 Antibody (NBP1-89486) (0)

There are no reviews for NIT2 Antibody (NBP1-89486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NIT2 Antibody (NBP1-89486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIT2 Products

Bioinformatics Tool for NIT2 Antibody (NBP1-89486)

Discover related pathways, diseases and genes to NIT2 Antibody (NBP1-89486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIT2 Antibody (NBP1-89486)

Discover more about diseases related to NIT2 Antibody (NBP1-89486).
 

Pathways for NIT2 Antibody (NBP1-89486)

View related products by pathway.

PTMs for NIT2 Antibody (NBP1-89486)

Learn more about PTMs related to NIT2 Antibody (NBP1-89486).
 

Research Areas for NIT2 Antibody (NBP1-89486)

Find related products by research area.

Blogs on NIT2

There are no specific blogs for NIT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIT2