Niemann-Pick type C1 Like-1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Niemann-Pick type C1 Like-1 Antibody - BSA Free (NBP2-94542) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1030-1100 of human Niemann-Pick type C1 Like-1 (NP_001095118.1). AAYSTSVNLTSDGQVLASRFMAYHKPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NPC1L1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:1000 - 1:5000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Niemann-Pick type C1 Like-1 Antibody - BSA Free
Background
Dietary consumption and intestinal cholesterol absorption contribute to plasma cholesterol levels, which factor into the risk of coronary heart disease. Niemann-Pick type C1 Like 1 protein (NPC1L1 or NPC3) is enriched in the small intestine and is found in the brush border membrane of enterocytes. It plays a critical role in absorption of intestinal cholesterol.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, Flow, ICC/IF (-), IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Dr, Hu, Mu
Applications: WB
Species: Ch, Hu
Applications: ELISA, GS, ICC/IF, IP, WB
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IP, WB
Publications for Niemann-Pick type C1 Like-1 Antibody (NBP2-94542) (0)
There are no publications for Niemann-Pick type C1 Like-1 Antibody (NBP2-94542).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Niemann-Pick type C1 Like-1 Antibody (NBP2-94542) (0)
There are no reviews for Niemann-Pick type C1 Like-1 Antibody (NBP2-94542).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Niemann-Pick type C1 Like-1 Antibody (NBP2-94542) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Niemann-Pick type C1 Like-1 Products
Research Areas for Niemann-Pick type C1 Like-1 Antibody (NBP2-94542)
Find related products by research area.
|
Blogs on Niemann-Pick type C1 Like-1