NFAM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NFAM1 Antibody [NBP1-84424] - Staining of human tonsil shows moderate membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: NFAM1 Antibody [NBP1-84424] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: NFAM1 Antibody [NBP1-84424] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: NFAM1 Antibody [NBP1-84424] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NFAM1 Antibody [NBP1-84424] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and NFAM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403444).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFAM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFAM1 Antibody - BSA Free (NBP1-84424) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFAM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NFAM1 Recombinant Protein Antigen (NBP1-84424PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NFAM1 Antibody - BSA Free

• calcinerin/NFAT-activating ITAM-containing protein
• Calcineurin/NFAT-activating ITAM-containing protein
• CNAIP
• CNAIPbK126B4.4
• FLJ40652
• NFAM1
• NFAT activating protein with ITAM motif 1
• NFAT activation molecule 1
• NFAT-activating protein with ITAM motif 1

Background

NFAM1 is encoded by this gene is a type I membrane receptor that activates cytokine gene promoters such as the IL-13 and TNF-alpha promoters. The encoded protein contains an immunoreceptor tyrosine-based activation motif (ITAM) and is thought to regulate the signaling and development of B-cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFAM1