NF-L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NF-L Antibody [NBP2-58699] - Staining of human cell line PC-3 shows localization to nuclear speckles & intermediate filaments.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NF-L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF
Specificity
Specificity of human NF-L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEFL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NF-L Antibody

  • 68 kDa neurofilament protein
  • CMT2E
  • NEFL
  • neurofilament protein, light chain
  • neurofilament subunit NF-L
  • Neurofilament triplet L protein
  • neurofilament, light polypeptide
  • neurofilament-light
  • NF68
  • NF68FLJ53642
  • NFL
  • NF-L
  • NFLlight polypeptide 68kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-222
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq
Applications: WB, IB, ICC/IF, IHC, IHC-FrFl, KD
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
7954-GM/CF
Species: Hu
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NB300-140
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NB300-137
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-53381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, KD
NBP2-58699
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for NF-L Antibody (NBP2-58699) (0)

There are no publications for NF-L Antibody (NBP2-58699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NF-L Antibody (NBP2-58699) (0)

There are no reviews for NF-L Antibody (NBP2-58699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NF-L Antibody (NBP2-58699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NF-L Products

Bioinformatics Tool for NF-L Antibody (NBP2-58699)

Discover related pathways, diseases and genes to NF-L Antibody (NBP2-58699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF-L Antibody (NBP2-58699)

Discover more about diseases related to NF-L Antibody (NBP2-58699).
 

Pathways for NF-L Antibody (NBP2-58699)

View related products by pathway.

PTMs for NF-L Antibody (NBP2-58699)

Learn more about PTMs related to NF-L Antibody (NBP2-58699).
 

Research Areas for NF-L Antibody (NBP2-58699)

Find related products by research area.

Blogs on NF-L

There are no specific blogs for NF-L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF-L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEFL