NF-H Antibody - BSA Free

Immunohistochemistry-Paraffin: NF-H Antibody [NBP2-37984] - Staining of human liver shows no positivity as expected.

Immunohistochemistry-Paraffin: NF-H Antibody [NBP2-37984] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: NF-H Antibody [NBP2-37984] - Analysis in human cerebral cortex and liver tissues. Corresponding NF-H RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NF-H Antibody [NBP2-37984] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: NF-H Antibody [NBP2-37984] - Staining of human cerebral cortex shows strong membranous positivity in neuropil.

Immunohistochemistry-Paraffin: NF-H Antibody [NBP2-37984] - Staining of human kidney shows no positivity as expected.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NF-H Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEFH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NF-H Recombinant Protein Antigen (NBP2-37984PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NF-H Antibody - BSA Free

• 200 kDa neurofilament protein
• KIAA0845
• NEFH
• Neurofilament Heavy (200kDa)
• neurofilament heavy polypeptide
• Neurofilament triplet H protein
• neurofilament, heavy polypeptide 200kDa
• neurofilament, heavy polypeptide
• NF200
• NFH
• NF-H

Background

Neurofilaments are 10nm intermediate filament proteins located in vertebrate neurons, which regulate axonal diameter. They are composed predominantly of the three major neurofilament proteins: NF-Light, NF-Medium and NF-Heavy. NF-H is the heavy or high molecular weight microfilament subunit and runs on SDS-PAGE gels in the range 180-220kDa, with some size variation in across species.

Antibodies to NF-H may be used to identify NF-H in neurons and to study neuronal processes in tissue sections and/or culture. NF-H antibodies can also be used to study microfilament accumulations seen in many neurological diseases, such as Lou Geri's disease or Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEFH
• Uniprot:
  • P12036()