NF-H Antibody (2671)

Images

 
Western Blot: NF-H Antibody (2671) [NBP2-46615] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: NF-H Antibody (2671) [NBP2-46615] - Staining of human tonsil shows absence of immunoreactivity (negative control).
Immunohistochemistry: NF-H Antibody (2671) [NBP2-46615] - Staining of human cerebellum shows moderate immunoreactivity in Purkinje cells and neural fibers.
Immunohistochemistry: NF-H Antibody (2671) [NBP2-46615] - Staining of human cerebral cortex shows moderate positivity in neural fibers.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
2671
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NF-H Antibody (2671) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE
Epitope
Binds to an epitope located within the peptide sequence ECRIGFGPIPFSLPE as determined by overlapping synthetic peptides.
Specificity
Specificity of human NF-H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
NEFH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
NF-H Lysate (NBP2-65371)
Control Peptide
NF-H Recombinant Protein Antigen (NBP2-46615PEP)

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for NF-H Antibody (2671)

  • 200 kDa neurofilament protein
  • KIAA0845
  • NEFH
  • Neurofilament Heavy (200kDa)
  • neurofilament heavy polypeptide
  • Neurofilament triplet H protein
  • neurofilament, heavy polypeptide 200kDa
  • neurofilament, heavy polypeptide
  • NF200
  • NFH
  • NF-H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-133
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IF
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB300-140
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
NB300-137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF1436
Species: Mu
Applications: WB
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl

Publications for NF-H Antibody (NBP2-46615) (0)

There are no publications for NF-H Antibody (NBP2-46615).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NF-H Antibody (NBP2-46615) (0)

There are no reviews for NF-H Antibody (NBP2-46615). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NF-H Antibody (NBP2-46615) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NF-H Antibody (NBP2-46615)

Discover related pathways, diseases and genes to NF-H Antibody (NBP2-46615). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF-H Antibody (NBP2-46615)

Discover more about diseases related to NF-H Antibody (NBP2-46615).
 

Pathways for NF-H Antibody (NBP2-46615)

View related products by pathway.

PTMs for NF-H Antibody (NBP2-46615)

Learn more about PTMs related to NF-H Antibody (NBP2-46615).
 

Research Areas for NF-H Antibody (NBP2-46615)

Find related products by research area.

Blogs on NF-H

There are no specific blogs for NF-H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF-H Antibody (2671) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEFH
Entrez
Uniprot