Neutrophil Elastase/ELA2 Recombinant Protein Antigen

Images

 
There are currently no images for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neutrophil Elastase/ELA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Neutrophil Elastase/ELA2.

Source: E. coli

Amino Acid Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELANE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57576.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neutrophil Elastase/ELA2 Recombinant Protein Antigen

  • Bone marrow serine protease
  • EC 3.4.21
  • EC 3.4.21.37
  • ELA2
  • ELA2granulocyte-derived elastase
  • ELANE
  • elastase 2, neutrophil
  • elastase, neutrophil expressed
  • Elastase-2
  • GE
  • HLEelastase-2
  • HNE
  • Human leukocyte elastase
  • Leukocyte Elastase
  • Medullasin
  • NE
  • Neutrophil Elastase
  • PMN elastase
  • PMN-E
  • polymorphonuclear elastase
  • SCN1

Background

The ELANE gene (commonly known as neutrophil elastase) encodes a 267 amino acid long, 28 kDA neutrophil elastase protein that functions in regulation of natural killer cells, monocytes, and graulocytes. ELANE is involved in activation of proMMP8, cell adhesion cell-matrix glycoconjugates, selected targets of C/EBPbeta, degradation of the extracellular matrix and collagen, and amb2 integrin signaling. It interacts with various genes GZMB, LRP1, SERPINF2, SERPING1, and SERPINA1. Elane has been linked to cystic fibrosis, asthma, pneumonia, alzheimer's disease, neutropenia, cutis laxia, leg ulcers, wegener's granulomatosis, bronchitis, adult respiratory distress syndrome, and vascular diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33498
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-25966
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DPI00
Species: Hu
Applications: ELISA
DY1707
Species: Hu
Applications: ELISA
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
7770-GT
Species: Hu
Applications: EnzAct
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
MAB1268
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
AF009
Species: Hu
Applications: IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP) (0)

There are no publications for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP) (0)

There are no reviews for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neutrophil Elastase/ELA2 Products

Research Areas for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP)

Find related products by research area.

Blogs on Neutrophil Elastase/ELA2

There are no specific blogs for Neutrophil Elastase/ELA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neutrophil Elastase/ELA2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ELANE