Neutrophil Elastase/ELA2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Neutrophil Elastase/ELA2. Source: E. coli Amino Acid Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ELANE |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57576. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Neutrophil Elastase/ELA2 Recombinant Protein Antigen
Background
The ELANE gene (commonly known as neutrophil elastase) encodes a 267 amino acid long, 28 kDA neutrophil elastase protein that functions in regulation of natural killer cells, monocytes, and graulocytes. ELANE is involved in activation of proMMP8, cell adhesion cell-matrix glycoconjugates, selected targets of C/EBPbeta, degradation of the extracellular matrix and collagen, and amb2 integrin signaling. It interacts with various genes GZMB, LRP1, SERPINF2, SERPING1, and SERPINA1. Elane has been linked to cystic fibrosis, asthma, pneumonia, alzheimer's disease, neutropenia, cutis laxia, leg ulcers, wegener's granulomatosis, bronchitis, adult respiratory distress syndrome, and vascular diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: AC
Publications for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP) (0)
There are no publications for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP) (0)
There are no reviews for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP) (0)
Additional Neutrophil Elastase/ELA2 Products
Research Areas for Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP)
Find related products by research area.
|
Blogs on Neutrophil Elastase/ELA2