Neuropilin-1 Antibody was developed against a Recombinant Protein corresponding to amino acids: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE
Predicted Species
Mouse (97%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
103 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Neuropilin-1 (also known as Npn-1, NRP1, neuropilin, or CD304/BDCA4) is a 923 amino acid (aa) type I transmembrane glycoprotein (theoretical molecular weight 130-140 kDa) located on human chromosome 10p11.22 that encodes multiple intact and soluble isoforms. The 623 aa extracellular domain (ECD) of this human cell surface receptor includes two CUB (complement-binding) domains, two F5/8 domains with homology to coagulation factors V and VIII, and a MAM (meprin) domain. The ECD of human Neuropilin-1 shares 92-95% aa sequence identity with mouse, rat, bovine, and canine Npn-1. The MAM domains of neuropilins are involved in the formation of homo- and hetero-oligomers in the absence of ligands. Neuropilin-1 expression is found in neuronal, endothelial and tumor cells as well as epithelial cells such as in the respiratory, gastrointestinal, lower urological tracts, thyroid, parathyroid and thymus gland (1,2). Initially found to play an essential role in axon growth and guidance, NRP1 serves as a multifunctional co-receptor for class III semaphorins and heparin-binding members of the VEGF family, participating in regulation of angiogenesis, neuronal development, cell survival, migration and tumor-invasion. Neuropilin-1 has been implicated in viral infections and T-cell activation and is also described as a marker of regulatory T (Treg) cells (3). In COVID-19 infections, studies have shown NRP1 participates in viral infection via NRP1 neutralizing antibodies and binds the SARS-CoV-2 Spike protein, suggesting NRP1 may contribute to viral transport and viral internalization by endocytosis (4).
References
1. Wild JRL, Staton CA, Chapple K, Corfe BM. (2012) Neuropilins: Expression and Roles in the Epithelium. Int J Exp Pathol. 93(2):81-103. PMID: 22414290
2. Bielenberg DR, Pettaway CA, Takashima S, Klagsbrun M. (2006) Neuropilins in Neoplasms: Expression, Regulation, and Function. Exp Cell Res. 312(5):584-93. PMID: 16445911
3. Tordjman R, Lepelletier Y, Lemarchandel V, Cambot M, Gaulard P, Hermine O, Romeo P-H. (2002). A Neuronal Receptor, neuropilin-1, Is Essential for the Initiation of the Primary Immune Response. Nat Immunol. 3(5):477-82. PMID: 11953749
4. Coronavirus research updates: Test frequency matters more than test sensitivity for stopping outbreaks. 2002 June 26. Nature.com
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for Neuropilin-1 Antibody (NBP1-85763). (Showing 1 - 2 of 2 FAQ).
If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?
If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.
What research areas can Neuropilin-1 antibodies be used in?
Neuropilin-1 products can be applied in the following research areas: Adaptive Immunity, Angiogenesis, Breast Cancer, Cancer, Cardiovascular Biology, Neuroscience, and Virology Bacteria and Parasites.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Neuropilin-1 Antibody - BSA Free and receive a gift card or discount.