Neuropilin-1 Antibody - BSA Free

Staining of human skeletal muscle shows low positivity in myocytes as expected.

Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neuropilin-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neuropilin-1 Antibody - BSA Free (NBP1-85763) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Neuropilin-1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Neuropilin-1 Antibody was developed against a Recombinant Protein corresponding to amino acids: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE
• Predicted Species: Mouse (97%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NRP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 103 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Neuropilin-1 Recombinant Protein Antigen (NBP1-85763PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neuropilin-1 Antibody - BSA Free

• BDCA4
• BDCA-4
• CD304 antigen
• CD304
• DKFZp686A03134
• DKFZp781F1414
• neuropilin 1
• Neuropilin1
• Neuropilin-1
• NP1
• NRP
• NRP1
• transmembrane receptor
• Vascular endothelial cell growth factor 165 receptor
• VEGF165R

Background

Neuropilin-1 (also known as Npn-1, NRP1, neuropilin, or CD304/BDCA4) is a 923 amino acid (aa) type I transmembrane glycoprotein (theoretical molecular weight 130-140 kDa) located on human chromosome 10p11.22 that encodes multiple intact and soluble isoforms. The 623 aa extracellular domain (ECD) of this human cell surface receptor includes two CUB (complement-binding) domains, two F5/8 domains with homology to coagulation factors V and VIII, and a MAM (meprin) domain. The ECD of human Neuropilin-1 shares 92-95% aa sequence identity with mouse, rat, bovine, and canine Npn-1. The MAM domains of neuropilins are involved in the formation of homo- and hetero-oligomers in the absence of ligands. Neuropilin-1 expression is found in neuronal, endothelial and tumor cells as well as epithelial cells such as in the respiratory, gastrointestinal, lower urological tracts, thyroid, parathyroid and thymus gland (1,2).
Initially found to play an essential role in axon growth and guidance, NRP1 serves as a multifunctional co-receptor for class III semaphorins and heparin-binding members of the VEGF family, participating in regulation of angiogenesis, neuronal development, cell survival, migration and tumor-invasion. Neuropilin-1 has been implicated in viral infections and T-cell activation and is also described as a marker of regulatory T (Treg) cells (3). In COVID-19 infections, studies have shown NRP1 participates in viral infection via NRP1 neutralizing antibodies and binds the SARS-CoV-2 Spike protein, suggesting NRP1 may contribute to viral transport and viral internalization by endocytosis (4).

References

1. Wild JRL, Staton CA, Chapple K, Corfe BM. (2012) Neuropilins: Expression and Roles in the Epithelium. Int J Exp Pathol. 93(2):81-103. PMID: 22414290

2. Bielenberg DR, Pettaway CA, Takashima S, Klagsbrun M. (2006) Neuropilins in Neoplasms: Expression, Regulation, and Function. Exp Cell Res. 312(5):584-93. PMID: 16445911

3. Tordjman R, Lepelletier Y, Lemarchandel V, Cambot M, Gaulard P, Hermine O, Romeo P-H. (2002). A Neuronal Receptor, neuropilin-1, Is Essential for the Initiation of the Primary Immune Response. Nat Immunol. 3(5):477-82. PMID: 11953749

4. Coronavirus research updates: Test frequency matters more than test sensitivity for stopping outbreaks. 2002 June 26. Nature.com

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Neuropilin-1 Antibody (NBP1-85763)(1)

Publication using NBP1-85763

• Venkova K, Christov A, Kamaluddin Z et al. Semaphorin 3A Signaling Through neuropilin-1 Is an Early Trigger for Distal Axonopathy in the SOD1G93A Mouse Model of Amyotrophic Lateral Sclerosis J Neuropathol Exp Neurol. 2014-07-01 [PMID: 24918638] (ICC/IF, ICC/IF, Mouse)
  
  Details:
  Neuropilin-1 antibody is used to investigate semaphorin 3A signaling through its NRP1 receptor and the hypothesis that this mechanism potentially triggers neuromuscular junction degeneration. A potential treatment of ALS is highlighted in the findings of this study.

FAQs for Neuropilin-1 Antibody (NBP1-85763). (Showing 1 - 2 of 2 FAQ).

1. If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?
   • If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.
2. What research areas can Neuropilin-1 antibodies be used in?
   • Neuropilin-1 products can be applied in the following research areas: Adaptive Immunity, Angiogenesis, Breast Cancer, Cancer, Cardiovascular Biology, Neuroscience, and Virology Bacteria and Parasites.

Bioinformatics

• Gene Symbol: NRP1