Neuroglycan C/CSPG5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CSPG5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Neuroglycan C/CSPG5 Antibody - BSA Free
Background
Many cellular activities depend on the interaction of cells with the surrounding extracellular matrix (ECM). Most cells, in intact tissue and in culture, are attached to an ECM. Epithelial cells are associated with the basement membrane; fibroblastic cells are usually embedded in a pericellular mesh of fibrils, and tissue culture cells usually grow on a substrate which is covered by various ECM components. Studies have indicated that the matrix or its various isolated components provide not only adhesive surfaces for cells to grow on but also have effects on the rate of cell growth, mobility, morphogenesis and differentiation. Within the ECM several glycoproteins and proteoglycans have been identified. It has been proposed that the different constituents interact with each other in a rather complex fashion. The poor antigenicity of proteoglycans especially their glycoaminoglycan (GAG) moieties make it difficult to localize these molecules in tissue and cell culture. Monoclonal Anti-Chondroitin Sulfate can be used to study chondroitin sulfate proteoglycan (CSPG) distribution and its relationships to specific cell-substrate contacts.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Neuroglycan C/CSPG5 Antibody (NBP2-56381) (0)
There are no publications for Neuroglycan C/CSPG5 Antibody (NBP2-56381).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuroglycan C/CSPG5 Antibody (NBP2-56381) (0)
There are no reviews for Neuroglycan C/CSPG5 Antibody (NBP2-56381).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Neuroglycan C/CSPG5 Antibody (NBP2-56381) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neuroglycan C/CSPG5 Products
Research Areas for Neuroglycan C/CSPG5 Antibody (NBP2-56381)
Find related products by research area.
|
Blogs on Neuroglycan C/CSPG5