NISCH Antibody

Images

 
Immunohistochemistry-Paraffin: NISCH Antibody [NBP1-81630] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NISCH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEV
Specificity
Specificity of human NISCH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NISCH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NISCH Protein (NBP1-81630PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NISCH Antibody

  • hIRAS
  • I-1 receptor candidate protein
  • I-1FLJ14425
  • I1R candidate protein
  • I1R
  • Imidazoline receptor 1
  • imidazoline receptor antisera selected
  • Imidazoline receptor antisera-selected protein
  • imidazoline receptor candidate
  • Imidazoline-1 receptor candidate protein
  • Imidazoline-1 receptor
  • IR1
  • IRASFLJ40413
  • KIAA0975FLJ90519
  • nischarin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-67695
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67726
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76996
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NISCH Antibody (NBP1-81630) (0)

There are no publications for NISCH Antibody (NBP1-81630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NISCH Antibody (NBP1-81630) (0)

There are no reviews for NISCH Antibody (NBP1-81630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NISCH Antibody (NBP1-81630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NISCH Antibody (NBP1-81630)

Discover related pathways, diseases and genes to NISCH Antibody (NBP1-81630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NISCH Antibody (NBP1-81630)

Discover more about diseases related to NISCH Antibody (NBP1-81630).
 

Pathways for NISCH Antibody (NBP1-81630)

View related products by pathway.

PTMs for NISCH Antibody (NBP1-81630)

Learn more about PTMs related to NISCH Antibody (NBP1-81630).
 

Research Areas for NISCH Antibody (NBP1-81630)

Find related products by research area.

Blogs on NISCH

There are no specific blogs for NISCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NISCH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NISCH