NEU-1/Sialidase-1 Antibody

Images

 
Western Blot: NEU-1/Sialidase-1 Antibody [NBP1-69387] - This Anti-NEU1 antibody was used in Western Blot of Fetal Pancreas tissue lysate at a concentration of 5ug/ml.
Immunohistochemistry: NEU-1/Sialidase-1 Antibody [NBP1-69387] - Human Muscle

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEU-1/Sialidase-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NEU1(sialidase 1 (lysosomal sialidase)) The peptide sequence was selected from the middle region of NEU1. Peptide sequence VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEU1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NEU-1/Sialidase-1 Antibody

  • Acetylneuraminyl hydrolase
  • EC 3.2.1.18
  • exo-alpha-sialidase
  • FLJ93471
  • G9 sialidase
  • Lysosomal sialidase
  • N-acetyl-alpha-neuraminidase 1
  • NANH
  • NEU
  • NEU1
  • NEU-1
  • SIAL1
  • sialidase 1 (lysosomal sialidase)
  • Sialidase-1

Background

NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.The protein encoded by this gene encodes the lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-69387
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NEU-1/Sialidase-1 Antibody (NBP1-69387) (0)

There are no publications for NEU-1/Sialidase-1 Antibody (NBP1-69387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEU-1/Sialidase-1 Antibody (NBP1-69387) (0)

There are no reviews for NEU-1/Sialidase-1 Antibody (NBP1-69387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEU-1/Sialidase-1 Antibody (NBP1-69387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEU-1/Sialidase-1 Products

Bioinformatics Tool for NEU-1/Sialidase-1 Antibody (NBP1-69387)

Discover related pathways, diseases and genes to NEU-1/Sialidase-1 Antibody (NBP1-69387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEU-1/Sialidase-1 Antibody (NBP1-69387)

Discover more about diseases related to NEU-1/Sialidase-1 Antibody (NBP1-69387).
 

Pathways for NEU-1/Sialidase-1 Antibody (NBP1-69387)

View related products by pathway.

PTMs for NEU-1/Sialidase-1 Antibody (NBP1-69387)

Learn more about PTMs related to NEU-1/Sialidase-1 Antibody (NBP1-69387).

Blogs on NEU-1/Sialidase-1

There are no specific blogs for NEU-1/Sialidase-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEU-1/Sialidase-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEU1
Entrez
Uniprot