NEU-1/Sialidase-1 Antibody - BSA Free

Western Blot: NEU-1/Sialidase-1 Antibody [NBP1-69387] - This Anti-NEU1 antibody was used in Western Blot of Fetal Pancreas tissue lysate at a concentration of 5ug/ml.

Immunohistochemistry: NEU-1/Sialidase-1 Antibody [NBP1-69387] - Human Muscle

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

NEU-1/Sialidase-1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NEU1(sialidase 1 (lysosomal sialidase)) The peptide sequence was selected from the middle region of NEU1. Peptide sequence VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEU1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NEU-1/Sialidase-1 Antibody - BSA Free

• Acetylneuraminyl hydrolase
• EC 3.2.1.18
• exo-alpha-sialidase
• FLJ93471
• G9 sialidase
• Lysosomal sialidase
• N-acetyl-alpha-neuraminidase 1
• NANH
• NEU
• NEU1
• NEU-1
• SIAL1
• sialidase 1 (lysosomal sialidase)
• Sialidase-1

Background

NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.The protein encoded by this gene encodes the lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEU1
• Uniprot:
  • Q99519()