Nestin Antibody - BSA Free

Immunohistochemistry-Paraffin: Nestin Antibody [NBP2-48575] - Staining in human kidney and liver tissues using anti-NES antibody. Corresponding NES RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Nestin Antibody [NBP2-48575] - Staining of human heart muscle, kidney, liver and lymph node using Anti-NES antibody NBP2-48575 (A) shows similar protein distribution across tissues to independent antibody NBP2-48504 (B).

Western Blot: Nestin Antibody [NBP2-48575] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30

Immunocytochemistry/Immunofluorescence: Nestin Antibody [NBP2-48575] - Staining of human cell line AF22 shows localization to intermediate filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Nestin Antibody [NBP2-48575] - Staining of human kidney using Anti-NES antibody NBP2-48575.

Immunohistochemistry-Paraffin: Nestin Antibody [NBP2-48575] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Nestin Antibody [NBP2-48575] - Staining of human heart muscle.

Immunohistochemistry-Paraffin: Nestin Antibody [NBP2-48575] - Staining of human lymph node.

Immunohistochemistry-Paraffin: Nestin Antibody [NBP2-48575] - Staining of human liver using Anti-NES antibody NBP2-48575.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nestin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EPLRSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLGEQDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NES
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Nestin Recombinant Protein Antigen (NBP2-48575PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nestin Antibody - BSA Free

• FLJ21841
• NES
• Nestin

Background

Nestin is a Class VI intermediate filament expressed in the developing central nervous system in early embryonic neuroepithelial stem cells. This protein has been widely used as a predominant marker for stem / progenitor cells, glioma cells, and tumor endothelial cells. Furthermore, it is a superior angiogenic marker to evaluate neovascularity of endothelial cells in tumor. Because if it's roles in angiogenisis and tumorgenesis, Nestin antibodies are useful cancer markers.

Although it is often used as a marker for proliferating and migrating cells very little is known about Nestin's function or regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NES