NDUFV2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NDUFV2 Antibody [NBP2-58837] - Staining of human cell line U-2 OS shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFV2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFV2 Antibody - BSA Free (NBP2-58837) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNY',)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFV2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NDUFV2 Recombinant Protein Antigen (NBP2-58837PEP)

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFV2 Antibody - BSA Free

• CI-24k
• mitochondrial respitory chain, 24 kD subunit
• NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD)
• NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
• NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
• NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial
• NADH-ubiquinone oxidoreductase 24 kDa subunit
• NADH-ubiquinone oxidoreductase flavoprotein 2
• nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

Background

NDUFV2 is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Complex I is composed of 45 different subunits. This is a component of the flavoprotein-sulfur (FP) fragment of the enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFV2