Dysbindin Antibody

Images

 
Western Blot: Dysbindin Antibody [NBP1-85299] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Dysbindin Antibody [NBP1-85299] - Staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human liver shows negative positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dysbindin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTNBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dysbindin Protein (NBP1-85299PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dysbindin Antibody

  • DKFZp564K192
  • dysbindin
  • dysbindin-1
  • dystrobrevin binding protein 1
  • Dystrobrevin-binding protein 1
  • FLJ30031
  • Hermansky-Pudlak syndrome 7 protein
  • HPS7 protein
  • HPS7DBND
  • MGC20210
  • My031
  • SDY

Background

Dysbindin encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dysbindin Antibody (NBP1-85299) (0)

There are no publications for Dysbindin Antibody (NBP1-85299).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dysbindin Antibody (NBP1-85299) (0)

There are no reviews for Dysbindin Antibody (NBP1-85299). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dysbindin Antibody (NBP1-85299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dysbindin Products

Research Areas for Dysbindin Antibody (NBP1-85299)

Find related products by research area.

Blogs on Dysbindin

There are no specific blogs for Dysbindin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dysbindin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTNBP1