NDUFS8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NDUFS8 Antibody [NBP1-85620] - Staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemistry-Paraffin: NDUFS8 Antibody [NBP1-85620] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunocytochemistry/ Immunofluorescence: NDUFS8 Antibody [NBP1-85620] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFS8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFS8 Protein (NBP1-85620PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFS8 Antibody

  • CI-23k
  • CI23KD
  • CI-23kD
  • complex I 23kDa subunit
  • Complex I-23kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • NADH dehydrogenase (ubiquinone) Fe-S protein 8 (23kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
  • NADH-ubiquinone oxidoreductase 23 kDa subunit
  • TYKY subunit
  • TYKY

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00374291-P01
Species: Hu
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004700-R01
Species: Hu
NBP1-31465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-26161
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-57265
Species: Hu
Applications: WB, ICC/IF
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85620
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for NDUFS8 Antibody (NBP1-85620) (0)

There are no publications for NDUFS8 Antibody (NBP1-85620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS8 Antibody (NBP1-85620) (0)

There are no reviews for NDUFS8 Antibody (NBP1-85620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NDUFS8 Antibody (NBP1-85620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFS8 Products

Bioinformatics Tool for NDUFS8 Antibody (NBP1-85620)

Discover related pathways, diseases and genes to NDUFS8 Antibody (NBP1-85620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS8 Antibody (NBP1-85620)

Discover more about diseases related to NDUFS8 Antibody (NBP1-85620).
 

Pathways for NDUFS8 Antibody (NBP1-85620)

View related products by pathway.

PTMs for NDUFS8 Antibody (NBP1-85620)

Learn more about PTMs related to NDUFS8 Antibody (NBP1-85620).

Blogs on NDUFS8

There are no specific blogs for NDUFS8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFS8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS8