Ndufs1 Antibody

Images

 
Western Blot: Ndufs1 Antibody [NBP1-56520] - Lanes: Lane1 : 30 ug Human liver Lane2: 30 ug Rat liver Lane3: 30 ug Mouse (wild-type) liver Lane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver Lane5: 30 ug Human muscle Lane6: ...read more
Western Blot: Ndufs1 Antibody [NBP1-56520] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Western Blot: Ndufs1 Antibody [NBP1-56520] - Nuclear lysates at 1:1000.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ndufs1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NDUFS1 (NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)) The peptide sequence was selected from the middle region of NDUFS1)(50ug). Peptide sequence TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: mitochondrial.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NDUFS1 and was validated on Western blot.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-56520 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ndufs1 Antibody

  • CI-75k
  • CI-75kD
  • complex I 75kDa subunit
  • complex I, mitochondrial respiratory chain, 75-kD subunit
  • Complex I-75kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 7.1.1.2
  • MGC26839
  • mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit
  • NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase)
  • NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
  • Ndufs1
  • PRO1304

Background

The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33074
Species: Hu, Mu
Applications: IHC, IHC-P, KO, WB
NBP2-76885
Species: Hu, Mu, Rt, Ze
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-49846
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-46127
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-76953
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-84475
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-93442
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-80861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
NBP1-82662
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-49831
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-86899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP3-05606
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for Ndufs1 Antibody (NBP1-56520) (0)

There are no publications for Ndufs1 Antibody (NBP1-56520).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Ndufs1 Antibody (NBP1-56520) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-56520:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
Verified Customer
Western Blot Mouse 03/12/2019
View

Summary

ApplicationWestern Blot
Sample Testedskeletal muscle mitochondria
SpeciesMouse
LotQC28550-43399

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ndufs1 Antibody (NBP1-56520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ndufs1 Products

Bioinformatics Tool for Ndufs1 Antibody (NBP1-56520)

Discover related pathways, diseases and genes to Ndufs1 Antibody (NBP1-56520). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ndufs1 Antibody (NBP1-56520)

Discover more about diseases related to Ndufs1 Antibody (NBP1-56520).
 

Pathways for Ndufs1 Antibody (NBP1-56520)

View related products by pathway.

PTMs for Ndufs1 Antibody (NBP1-56520)

Learn more about PTMs related to Ndufs1 Antibody (NBP1-56520).
 

Research Areas for Ndufs1 Antibody (NBP1-56520)

Find related products by research area.

Blogs on Ndufs1

There are no specific blogs for Ndufs1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Verified Customer
03/12/2019
Application: Western Blot
Species: Mouse

Bioinformatics

Gene Symbol NDUFS1
Uniprot