Ndufs1 Antibody - BSA Free

Western Blot: Ndufs1 Antibody [NBP1-56520] - Lanes: Lane1 : 30 ug Human liver Lane2: 30 ug Rat liver Lane3: 30 ug Mouse (wild-type) liver Lane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver Lane5: 30 ug Human muscle Lane6: 30 ug Rat muscle Lane7: 30 ug Mouse muscle Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Secondary, Antibody Dilution: 1 : 10000 Gene name: NDUFS1.

Western Blot: Ndufs1 Antibody [NBP1-56520] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Western Blot: Ndufs1 Antibody [NBP1-56520] - Nuclear lysates at 1:1000.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Ndufs1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NDUFS1 (NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)) The peptide sequence was selected from the middle region of NDUFS1)(50ug). Peptide sequence TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: mitochondrial.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Ndufs1 Antibody - BSA Free

• CI-75k
• CI-75kD
• complex I 75kDa subunit
• complex I, mitochondrial respiratory chain, 75-kD subunit
• Complex I-75kD
• EC 1.6.5.3
• EC 1.6.99.3
• EC 7.1.1.2
• MGC26839
• mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit
• NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase)
• NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase)
• NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
• Ndufs1
• PRO1304

Background

The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Ndufs1 Antibody (NBP1-56520) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: zhenqi zhou WB Mouse 03/12/2019

Summary

• Application: Western Blot
• Sample Tested: skeletal muscle mitochondria
• Species: Mouse
• Lot: QC28550-43399

Bioinformatics

• Gene Symbol: NDUFS1
• Uniprot:
  • P28331(Human)