NDUFB6 Antibody

Images

 
Western Blot: NDUFB6 Antibody [H00004712-B01P] - Analysis of NDUFB6 expression in human spleen.
Western Blot: NDUFB6 Antibody [H00004712-B01P] - Analysis of NDUFB6 expression in transfected 293T cell line by NDUFB6 polyclonal antibody. Lane 1: NDUFB6 transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFB6 Antibody Summary

Immunogen
NDUFB6 (NP_002484.1, 1 a.a. - 128 a.a.) full-length human protein. MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
Specificity
NDUFB6 - NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NDUFB6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB6 Antibody

  • B17
  • CI
  • CI-B17
  • complex I, mitochondrial respiratory chain, B17 subunit
  • Complex I-B17
  • MGC13675
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
  • NADH-ubiquinone oxidoreductase B17 subunit
  • NADH-ubiquinone oxidoreductase beta subunit, 6

Background

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
H00004712-B01P
Species: Hu
Applications: WB

Publications for NDUFB6 Antibody (H00004712-B01P) (0)

There are no publications for NDUFB6 Antibody (H00004712-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB6 Antibody (H00004712-B01P) (0)

There are no reviews for NDUFB6 Antibody (H00004712-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB6 Antibody (H00004712-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB6 Products

Bioinformatics Tool for NDUFB6 Antibody (H00004712-B01P)

Discover related pathways, diseases and genes to NDUFB6 Antibody (H00004712-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB6 Antibody (H00004712-B01P)

Discover more about diseases related to NDUFB6 Antibody (H00004712-B01P).
 

Pathways for NDUFB6 Antibody (H00004712-B01P)

View related products by pathway.

PTMs for NDUFB6 Antibody (H00004712-B01P)

Learn more about PTMs related to NDUFB6 Antibody (H00004712-B01P).

Blogs on NDUFB6

There are no specific blogs for NDUFB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB6
Entrez
Uniprot