NDUFB10 Antibody

Images

 
Immunohistochemistry-Paraffin: NDUFB10 Antibody [NBP2-57790] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NDUFB10 Antibody [NBP2-57790] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NDUFB10 Antibody [NBP2-57790] - Staining in human heart muscle and pancreas tissues using anti-NDUFB10 antibody. Corresponding NDUFB10 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NDUFB10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAK
Specificity
Specificity of human NDUFB10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFB10 Recombinant Protein Antigen (NBP2-57790PEP)

Reactivity Notes

Mouse 82%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NDUFB10 Antibody

  • CI-PDSW
  • complex I PDSW subunit
  • Complex I-PDSW
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
  • NADH ubiquinone oxidoreductase PDSW subunit (RH 16p13.3)
  • NADH-ubiquinone oxidoreductase PDSW subunit
  • PDSW

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD
NB100-106
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB5938
Species: Hu
Applications: WB, ICC
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-80786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-19622
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67617
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-32396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002023-M01
Species: Hu, Fe
Applications: WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-93442
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57790
Species: Hu
Applications: IHC, IHC-P

Publications for NDUFB10 Antibody (NBP2-57790) (0)

There are no publications for NDUFB10 Antibody (NBP2-57790).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB10 Antibody (NBP2-57790) (0)

There are no reviews for NDUFB10 Antibody (NBP2-57790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NDUFB10 Antibody (NBP2-57790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDUFB10 Products

Bioinformatics Tool for NDUFB10 Antibody (NBP2-57790)

Discover related pathways, diseases and genes to NDUFB10 Antibody (NBP2-57790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB10 Antibody (NBP2-57790)

Discover more about diseases related to NDUFB10 Antibody (NBP2-57790).
 

Pathways for NDUFB10 Antibody (NBP2-57790)

View related products by pathway.

PTMs for NDUFB10 Antibody (NBP2-57790)

Learn more about PTMs related to NDUFB10 Antibody (NBP2-57790).
 

Research Areas for NDUFB10 Antibody (NBP2-57790)

Find related products by research area.

Blogs on NDUFB10

There are no specific blogs for NDUFB10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB10