![Western Blot: MT-CO2 Antibody [NBP2-37930] - Analysis using Anti-MT-CO2 antibody NBP2-37930 (A) shows similar pattern to independent antibody NBP2-37945 (B).](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Western-Blot-NBP2-37930-img0004.jpg "Western Blot: MT-CO2 Antibody [NBP2-37930] - Analysis using Anti-MT-CO2 antibody NBP2-37930 (A) shows similar pattern to independent antibody NBP2-37945 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEIGPVFT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COX2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MT-CO2 Antibody (NBP2-37930)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human stomach shows strong granular cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0012.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human stomach shows strong granular cytoplasmic positivity in parietal cells.")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human liver.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0005.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human liver.")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human lymph node.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0006.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human heart muscle.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0007.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human heart muscle.")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human kidney.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0008.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human cerebellum, kidney, liver and stomach using Anti-MT-CO2 antibody NBP2-37930 (A) shows similar protein distribution across tissues to independent antibody NBP2-37945 (B).](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0009.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human cerebellum, kidney, liver and stomach using Anti-MT-CO2 antibody NBP2-37930 (A) shows similar protein distribution across tissues to independent antibody NBP2-37945 (B).")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0010.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0011.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/MT-CO2-Antibody-Immunohistochemistry-Paraffin-NBP2-37930-img0013.jpg "Immunohistochemistry-Paraffin: MT-CO2 Antibody [NBP2-37930] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")