NDRG2 Antibody [DyLight 650]

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

NDRG2 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 138-357 of human NDRG2 (NP_963832.1).
  
  Sequence:
  LARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDRG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for NDRG2 Antibody [DyLight 650]

• DKFZp781G1938
• FLJ25522
• KIAA1248cytoplasmic protein Ndr1
• NDR1-related protein NDR2
• NDRG family member 2
• protein NDRG2
• Protein Syld709613
• syld709613 protein
• SYLDN-myc downstream regulator 2

Background

NDRG2 is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDRG2