Home » NDC80 » NDC80 Antibodies » NDC80 Antibody (1A10)

NDC80 Antibody (1A10)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NDC80 Antibody (1A10) [H00010403-M01] - KNTC2 monoclonal antibody (M01), clone 1A10 Analysis of KNTC2 expression in Hela S3 NE.
Western Blot: NDC80 Antibody (1A10) [H00010403-M01] - KNTC2 monoclonal antibody (M01), clone 1A10 Analysis of KNTC2 expression in Hela S3 NE.
Sandwich ELISA: NDC80 Antibody (1A10) [H00010403-M01] - Detection limit for recombinant GST tagged KNTC2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NDC80 Antibody (1A10) Summary

Immunogen
KNTC2 (AAH35617, 545 a.a. ~ 642 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
Specificity
KNTC2 - kinetochore associated 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDC80
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00010403-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDC80 Antibody (1A10)

  • HEC1KNTC2
  • HECRetinoblastoma-associated protein HEC
  • Highly expressed in cancer protein
  • highly expressed in cancer, rich in leucine heptad repeats (yeast)
  • highly expressed in cancer, rich in leucine heptad repeats
  • hsHec1
  • hsNDC80
  • kinetochore associated 2
  • Kinetochore protein Hec1
  • kinetochore protein NDC80 homolog
  • Kinetochore-associated protein 2
  • NDC80 homolog, kinetochore complex component (S. cerevisiae)
  • TID3

Background

HEC is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nuf2 Antibody
NBP1-31632
Immunocytochemistry/Immunofluorescence: Nuf2 Antibody [NBP1-31632] - A431 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CDCA1 protein stained by CDCA1 antibody [312] diluted at 1:200. Blue: Hoechst 33342 staining.
Immunocytochemistry/Immunofluorescence: Nuf2 Antibody [NBP1-31632] - Confocal immunofluorescence analysis (Olympus FV10i) of paraformaldehyde-fixed U2OS, using CDCA1antibody (Geen) at 1:500 dilution. Alpha-tubulin filaments were labeled with (Red) at 1:2000.
Western Blot: Nuf2 Antibody [NBP1-31632] - HeLa whole cell and nuclear extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with NUF2 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu
Applications: ICC/IF, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(738 Publications)
Species: Hu
Applications: BA
SPC24 Antibody
NBP2-47264
Immunocytochemistry/Immunofluorescence: SPC24 Antibody [NBP2-47264] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: SPC24 Antibody [NBP2-47264] - Staining of human testis shows moderate nuclear positivity in cells in subset of cells in seminiferus ducts.
Western Blot: SPC24 Antibody [NBP2-47264] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CENPA Antibody
NBP2-92632
Immunocytochemistry/Immunofluorescence: CENPA Antibody [NBP2-92632] - Analysis of U-2 OS cells using CENPA . Blue: DAPI for nuclear staining.
Western Blot: CENPA Antibody [NBP2-92632] - Analysis of extracts of various cell lines, using CENPA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAD2L1 Antibody
NB100-563
Immunohistochemistry: MAD2L1 Antibody [NB100-563] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- MAD2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MAD2L1 Antibody [NB100-563] - Detection of human MAD2L1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MAD2L1 antibody NB100-563 (lot 3) used for IP at 3 ug/mg lysate. MAD2L1 was also immunoprecipitated by a previous lot (lot 2) and by rabbit anti-MAD2L1 antibody NB100-564. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(14 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MIS12 Antibody
NB100-2359
Immunohistochemistry: MIS12 Antibody [NB100-2359] - Detection of human MIS12 by immunohistochemistry. Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-MIS12 (NB100-2359). Detection: DAB
Immunoprecipitation: MIS12 Antibody [NB100-2359] - Detection of human MIS12 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-MIS12 antibody NB100-2359 used for IP at 3 ug per reaction. MIS12 was also immunoprecipitated by rabbit anti-MIS12 antibody NB100-2358. For blotting immunoprecipitated MIS12, NB100-2359 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: MIS12 Antibody [NB100-2359] - Detection of human MIS12 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-MIS12 antibody NB100-2359 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(2 Publications)
Species: Hu
Applications: IHC, IP, WB
SPC25 Antibody
NBP2-47263
Immunocytochemistry/Immunofluorescence: SPC25 Antibody [NBP2-47263] - Staining of human cell line U-251 MG shows localization to cytosol.
Western Blot: SPC25 Antibody [NBP2-47263] - Analysis in human cell line U-2 OS.
Immunohistochemistry-Paraffin: SPC25 Antibody [NBP2-47263] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Mxi1 Antibody
(PCRP-MXI1-1A3)
NBP3-07374
Protein Array: Mxi1 Antibody (PCRP-MXI1-1A3) [NBP3-07374] - Analysis of Protein Array containing more than 19,000 full-length human proteins using Mxi1 Mouse Monoclonal Antibody (PCRP-Mxi1-1A3).
Flow Cytometry: Mxi1 Antibody (PCRP-MXI1-1A3) [NBP3-07374] - Flow Cytometric Analysis of PFA-fixed HeLa cells. Mxi1 Mouse Monoclonal Antibody (PCRP-Mxi1-1A3) followed by goat anti- Mouse IgG-CF488 (blue); unstained cells (red).
Immunocytochemistry/Immunofluorescence: Mxi1 Antibody (PCRP-MXI1-1A3) [NBP3-07374] - Immunofluorescence analysis of PFA-fixed HeLa cells. Mxi1 Mouse Monoclonal Antibody (PCRP-Mxi1-1A3)
Species: Hu
Applications: Flow, ICC/IF, PA, WB
Aurora B Antibody
- BSA Free
NB100-294
Immunocytochemistry/Immunofluorescence: Aurora B Antibody - BSA Free [NB100-294] - HeLa human cervix epitheloid carcinoma cells were fixed and permeabilized with 4% paraformaldehyde followed by cold methanol. Fixed cells were stained with 1:50 Anti-Aurora B antibody produced in rabbit. The antibody was developed using Anti-Rabbit IgG (whole molecule)-FITC antibody produced in goat.
Western Blot: Aurora B Antibody - BSA Free [NB100-294] - Whole extract of PC-12 cells were separated on SDS-PAGE and probed with Anti-Aurora B antibody produced in Rabbit. The antibody was developed using 1:10,000 Anti-Rabbit IgG (whole molecule)-Peroxidase antibody produced in Goat.Lanes:1. 1:1000 antibody2. 1:2000 antibody3. Negative Control
(5 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
MAD1L1/MAD1
Antibody
NBP1-32775
Immunohistochemistry-Paraffin: MAD1L1/MAD1 Antibody [NBP1-32775] - Paraffin-embedded SW480 Xenograft, using antibody at 1:100 dilution.
Western Blot: MAD1L1/MAD1 Antibody [NBP1-32775] - Sample (30 ug of whole cell lysate) A: Molt-4 7.5% SDS PAGE diluted at 1:10000
Western Blot: MAD1L1/MAD1 Antibody [NBP1-32775] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat 2 whole cell lysate/extract 7.5% SDS-PAGE MAD1 antibody dilution: 1:3000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Mad Antibody
NBP2-85249
Western Blot: Mad Antibody [NBP2-85249] - WB Suggested Anti-MXD1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle
Western Blot: Mad Antibody [NBP2-85249] - Host: Rabbit. Target: MXD1. Positive control (+): Mouse small intestine (M-IN). Negative control (-): Mouse testis (M-TE). Antibody concentration: 1ug/ml
Western Blot: Mad Antibody [NBP2-85249] - Host: Mouse. Target Name: MXD1. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Species: Hu, Mu
Applications: WB
CASC5 Antibody
NB100-2586
Western Blot: CASC5 Antibody [NB100-2586] - Whole cell lysate (50 ug) from HeLa, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CASC5 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 75 seconds.
Immunoprecipitation: CASC5 Antibody [NB100-2586] - Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbitanti-CASC5 antibody used for IP at 6 ug per reaction. CASC5 was alsoimmunoprecipitated by a previous lot of this antibodyl. For blotting immunoprecipitated CASC5, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: CASC5 Antibody [NB100-2586] - ASPP1/2 interact with multiple kinetochore components. Endogenous ASPP1/2 interact with multiple kinetochore components. Immunoprecipitation with anti-ASPP1 or ASPP2 antibodies were performed using cell lysates prepared from HeLa cells. The presence of kinetochore components in the immunoprecipitates was detected by WB analyses with their indicated antibodies. Image collected and cropped by CiteAb from the following publication (http://www.oncotarget.com/fulltext/6355), licensed under a CC-BY licence.
(3 Publications)
Species: Hu
Applications: ICC/IF, IP, WB
BCAS2 Antibody
NB110-40681
Immunohistochemistry-Paraffin: BCAS2 Antibody [NB110-40681] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BCAS2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB.
Immunohistochemistry-Paraffin: BCAS2 Antibody [NB110-40681] - Mouse plasmacytoma. Antibody: Affinity purified rabbit anti-BCAS2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB.
Immunoprecipitation: BCAS2 Antibody [NB110-40681] - Detection of human BCAS2 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from MCF-7 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BCAS2 antibody NB110-40681 (lot NB110-40681-2) used for IP at 6 ug per reaction. BCAS2 was also immunoprecipitated by a previous lot of this antibody (lot NB110-40681-1) and another rabbit anti-BCAS2 antibody. For blotting immunoprecipitated BCAS2, NB110-40681 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
CENPH Antibody
NBP1-82546
Immunohistochemistry-Paraffin: CENPH Antibody [NBP1-82546] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: CENPH Antibody [NBP1-82546] - Staining of human skin shows weak to moderate nuclear positivity in a subset of squamous epithelial cells.
Immunohistochemistry-Paraffin: CENPH Antibody [NBP1-82546] - Staining of human small intestine shows weak to moderate nuclear positivity in a subset of glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB/CF
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB/CF) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(521 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(2 Reviews)
(413 Publications)
Species: Hu
Applications: BA
TTK Antibody
(689913)
MAB6028
Western blot shows lysates of A431 human epithelial carcinoma cell line and HeLa human cervical epithelial carcinoma cell line. PVDF Membrane was probed with 2 µg/mL of Human TTK Monoclonal Antibody (Catalog # MAB6028) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for TTK at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: WB
IL-6 [HRP]
D6050
(693 Publications)
Species: Hu
Applications: ELISA
Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Integrin  beta 2/CD18 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using 10 µg/mL Goat Anti-Human Integrin  beta 2/CD18 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1730) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(11 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NDC80 Antibody
(1A10)
H00010403-M01
NDC80 Antibody (1A10)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for NDC80 Antibody (H00010403-M01)(1)


Reviews for NDC80 Antibody (H00010403-M01) (0)

There are no reviews for NDC80 Antibody (H00010403-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDC80 Antibody (H00010403-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDC80 Products

Bioinformatics Tool for NDC80 Antibody (H00010403-M01)

Discover related pathways, diseases and genes to NDC80 Antibody (H00010403-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDC80 Antibody (H00010403-M01)

Discover more about diseases related to NDC80 Antibody (H00010403-M01).
 

Pathways for NDC80 Antibody (H00010403-M01)

View related products by pathway.

PTMs for NDC80 Antibody (H00010403-M01)

Learn more about PTMs related to NDC80 Antibody (H00010403-M01).
 

Research Areas for NDC80 Antibody (H00010403-M01)

Find related products by research area.

Blogs on NDC80

There are no specific blogs for NDC80, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDC80 Antibody (1A10) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDC80
Entrez
OMIM
Uniprot