Orthogonal Strategies: Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining in human cerebral cortex and skin tissues.. Corresponding NCAM1 RNA-seq data are presented for the same tissues.
Western Blot: NCAM-1/CD56 Antibody [NBP2-38452] - Analysis in human brain tissue.
Immunocytochemistry/ Immunofluorescence: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human skin shows no positivity in keratinocytes.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Novus Biologicals Rabbit NCAM-1/CD56 Antibody - BSA Free (NBP2-38452) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NCAM-1/CD56 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCAM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for NCAM-1/CD56 Antibody - BSA Free
CD56 / NCAM-1
CD56 antigen
CD56
MSK39
NCAM1
N-CAM-1
NCAM-1
NCAMantigen recognized by monoclonal 5.1H11
neural cell adhesion molecule 1
neural cell adhesion molecule, NCAM
Background
NCAM, as a member of the immunoglobulin superfamily of adhesion molecules is characterized by several immunoglobulin (Ig) like domains. The extracellular part of NCAM consists of five of these Ig domains and two fibronectin type III homology regions. NCAM is encoded by a single copy gene composed of 26 exons. However, at least 20-30 distinct isoforms can be generated by alternative splicing and by posttranslational modifications, such as sialylation. During sialylation, polysialic acid (PSA) carbohydrates are attached to the extracellular part of NCAM. Through its extracellular region, NCAM mediates homophilic interactions. In addition, NCAM can also undergo heterophilic interactions by binding extracellular matrix components, such as laminin, or other cell adhesion molecules, such as integrins. NCAM is expressed on most neuroectodermal derived cell lines, tissues and neoplasm such as retinoblastoma, medulloblastoma, astrocytomas and neuroblastoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NCAM-1/CD56 Antibody - BSA Free and receive a gift card or discount.