NCAM-1/CD56 Antibody


Western Blot: NCAM-1/CD56 Antibody [NBP2-38452] - Analysis in human brain tissue.
Immunocytochemistry/ Immunofluorescence: NCAM-1/CD56 Antibody [NBP2-38452] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human skin shows no positivity in keratinocytes.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining in human cerebral cortex and skin tissues.. Corresponding NCAM1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

NCAM-1/CD56 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Specificity of human NCAM-1/CD56 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
NCAM-1/CD56 Lysate (NBP2-66335)
Control Peptide
NCAM-1/CD56 Protein (NBP2-38452PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NCAM-1/CD56 Antibody

  • CD56 / NCAM-1
  • CD56 antigen
  • CD56
  • MSK39
  • NCAM1
  • N-CAM-1
  • NCAM-1
  • NCAMantigen recognized by monoclonal 5.1H11
  • neural cell adhesion molecule 1
  • neural cell adhesion molecule, NCAM


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: Flow, CyTOF-ready
Species: Mu
Applications: Flow, IHC-Fr, IP, B/N
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, B/N

Publications for NCAM-1/CD56 Antibody (NBP2-38452) (0)

There are no publications for NCAM-1/CD56 Antibody (NBP2-38452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAM-1/CD56 Antibody (NBP2-38452) (0)

There are no reviews for NCAM-1/CD56 Antibody (NBP2-38452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCAM-1/CD56 Antibody (NBP2-38452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NCAM-1/CD56 Antibody (NBP2-38452)

Discover related pathways, diseases and genes to NCAM-1/CD56 Antibody (NBP2-38452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAM-1/CD56 Antibody (NBP2-38452)

Discover more about diseases related to NCAM-1/CD56 Antibody (NBP2-38452).

Pathways for NCAM-1/CD56 Antibody (NBP2-38452)

View related products by pathway.

PTMs for NCAM-1/CD56 Antibody (NBP2-38452)

Learn more about PTMs related to NCAM-1/CD56 Antibody (NBP2-38452).

Research Areas for NCAM-1/CD56 Antibody (NBP2-38452)

Find related products by research area.

Blogs on NCAM-1/CD56

There are no specific blogs for NCAM-1/CD56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NCAM-1/CD56 Antibody and receive a gift card or discount.


Gene Symbol NCAM1