NCAM-1/CD56 Antibody

Images

 
Western Blot: NCAM-1/CD56 Antibody [NBP2-38452] - Analysis in human brain tissue.
Immunocytochemistry/ Immunofluorescence: NCAM-1/CD56 Antibody [NBP2-38452] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human skin shows no positivity in keratinocytes.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining in human cerebral cortex and pancreas tissues using anti-NCAM1 antibody. Corresponding NCAM1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody [NBP2-38452] - Staining in human cerebral cortex and skin tissues.. Corresponding NCAM1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NCAM-1/CD56 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Specificity
Specificity of human NCAM-1/CD56 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCAM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
NCAM-1/CD56 Lysate (NBP2-66335)
Control Peptide
NCAM-1/CD56 Protein (NBP2-38452PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCAM-1/CD56 Antibody

  • CD56 / NCAM-1
  • CD56 antigen
  • CD56
  • MSK39
  • NCAM1
  • N-CAM-1
  • NCAM-1
  • NCAMantigen recognized by monoclonal 5.1H11
  • neural cell adhesion molecule 1
  • neural cell adhesion molecule, NCAM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67309
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-25200
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr

Publications for NCAM-1/CD56 Antibody (NBP2-38452) (0)

There are no publications for NCAM-1/CD56 Antibody (NBP2-38452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAM-1/CD56 Antibody (NBP2-38452) (0)

There are no reviews for NCAM-1/CD56 Antibody (NBP2-38452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCAM-1/CD56 Antibody (NBP2-38452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NCAM-1/CD56 Antibody (NBP2-38452)

Discover related pathways, diseases and genes to NCAM-1/CD56 Antibody (NBP2-38452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAM-1/CD56 Antibody (NBP2-38452)

Discover more about diseases related to NCAM-1/CD56 Antibody (NBP2-38452).
 

Pathways for NCAM-1/CD56 Antibody (NBP2-38452)

View related products by pathway.

PTMs for NCAM-1/CD56 Antibody (NBP2-38452)

Learn more about PTMs related to NCAM-1/CD56 Antibody (NBP2-38452).
 

Research Areas for NCAM-1/CD56 Antibody (NBP2-38452)

Find related products by research area.

Blogs on NCAM-1/CD56

There are no specific blogs for NCAM-1/CD56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCAM-1/CD56 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAM1
Entrez