NAT8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NAT8 Antibody [NBP2-57444] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAT8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCV
Specificity
Specificity of human NAT8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAT8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAT8 Recombinant Protein Antigen (NBP2-57444PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NAT8 Antibody

  • Camello-like protein 1
  • CML1
  • EC 2.3.1
  • EC 2.3.1.-
  • GLAkidney- and liver-specific gene product
  • Hcml1
  • N-acetyltransferase 8 (GCN5-related, putative)
  • N-acetyltransferase 8
  • probable N-acetyltransferase 8
  • TSC501N-acetyltransferase 8 (camello like)
  • TSC510

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-45844
Species: Hu
Applications: WB, IHC
NBP1-43390
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, B/N
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NAT8 Antibody (NBP2-57444) (0)

There are no publications for NAT8 Antibody (NBP2-57444).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAT8 Antibody (NBP2-57444) (0)

There are no reviews for NAT8 Antibody (NBP2-57444). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NAT8 Antibody (NBP2-57444) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAT8 Products

Bioinformatics Tool for NAT8 Antibody (NBP2-57444)

Discover related pathways, diseases and genes to NAT8 Antibody (NBP2-57444). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAT8 Antibody (NBP2-57444)

Discover more about diseases related to NAT8 Antibody (NBP2-57444).
 

Pathways for NAT8 Antibody (NBP2-57444)

View related products by pathway.

PTMs for NAT8 Antibody (NBP2-57444)

Learn more about PTMs related to NAT8 Antibody (NBP2-57444).

Blogs on NAT8

There are no specific blogs for NAT8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAT8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT8