NARFL Antibody

Images

 
Western Blot: NARFL Antibody [NBP1-83611] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NARFL Antibody [NBP1-83611] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: NARFL Antibody [NBP1-83611] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NARFL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKP
Specificity
Specificity of human NARFL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NARFL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NARFL Protein (NBP1-83611PEP)
Publications
Read Publication using
NBP1-83611 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%). Human reactivity reported in scientific literature (PMID: 25012650).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NARFL Antibody

  • cytosolic Fe-S cluster assembly factor NARFL
  • FLJ21988
  • HPRN
  • IOP1Protein related to Narf
  • Iron-only hydrogenase-like protein 1
  • LET1 like/JFP15
  • Nuclear prelamin A recognition factor-like protein
  • nuclear prelamin A recognition factor-like
  • PRNLET1L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-19474
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-Q01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00004068-M01
Species: Hu
Applications: WB, ELISA
6507-IL/CF
Species: Hu
NBP2-31928
Species: Hu
Applications: IHC, IHC-P

Publications for NARFL Antibody (NBP1-83611)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NARFL Antibody (NBP1-83611) (0)

There are no reviews for NARFL Antibody (NBP1-83611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NARFL Antibody (NBP1-83611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NARFL Antibody (NBP1-83611)

Discover related pathways, diseases and genes to NARFL Antibody (NBP1-83611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NARFL Antibody (NBP1-83611)

Discover more about diseases related to NARFL Antibody (NBP1-83611).
 

Pathways for NARFL Antibody (NBP1-83611)

View related products by pathway.

Blogs on NARFL

There are no specific blogs for NARFL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NARFL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NARFL