NARF Antibody

Images

 
Western Blot: NARF Antibody [NBP2-55660] - Cell lysate from MCF7 cells grown in DMEM medium. 30 ug cell lysate per lane. 10% SDS-PAGE. NARF antibody at 1:1000 dilution. HRP-conjugated secondary donkey anti-rabbit IgG ...read more
Immunocytochemistry/ Immunofluorescence: NARF Antibody [NBP2-55660] - SUM-159PT human breast cancer cell line. Antibody was used at 1:50 for labeling and microscopy analysis of the distribution of NARF proteins in ...read more
Western Blot: NARF Antibody [NBP2-55660] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: NARF Antibody [NBP2-55660] - ICC/IF of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is in green.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NARF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLG
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NARF
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/mL
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NARF Recombinant Protein Antigen (NBP2-55660PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP2-55660 in the following applications:

Reactivity Notes

Mouse 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NARF Antibody

  • FLJ10067
  • IOP2DKFZp434G0420
  • Iron-only hydrogenase-like protein 2
  • nuclear prelamin A recognition factor
  • prenyl-dependent prelamin A binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP1-54805
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-19622
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-1218
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP2-75717
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-65676
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl

Publications for NARF Antibody (NBP2-55660) (0)

There are no publications for NARF Antibody (NBP2-55660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NARF Antibody (NBP2-55660) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP2-55660:
Filter by Applications
IF
(1)
WB
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence NARF NBP2-55660
Enlarge
5
reviewed by:
Yongkang Yang
IF Human 03/17/2021
View

Summary

ApplicationImmunofluorescence
Sample TestedSUM-159PT human breast cancer cell line
SpeciesHuman
LotR70828
Western Blot NARF NBP2-55660
Enlarge
5
reviewed by:
Yongkang Yang
WB Human 08/16/2019
View

Summary

ApplicationWestern Blot
Sample TestedCell lysate from MCF7 cells grown in DMEM medium
SpeciesHuman
LotR70828

Comments

Comments30ug MCF-7 cell lysate/lane, 10% SDS-PAGE; Primary antibody (NARF Antibody (NBP2-55660), Lot: R70828): 1:1000 diluted in 5% milk incubate at 4℃ for overnight; Secondary antibody:
NA934V, Donkey Anti-Rabbit IgG Polyclonal Antibody (HRP (Horseradish Peroxidase)-  GE Healthcare
(Lot: 16908227) (1:2000 diluted in 5% milk). Incubate at room temperature for 1 hour.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NARF Antibody (NBP2-55660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NARF Products

Array NBP2-55660

Bioinformatics Tool for NARF Antibody (NBP2-55660)

Discover related pathways, diseases and genes to NARF Antibody (NBP2-55660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NARF Antibody (NBP2-55660)

Discover more about diseases related to NARF Antibody (NBP2-55660).
 

Pathways for NARF Antibody (NBP2-55660)

View related products by pathway.

PTMs for NARF Antibody (NBP2-55660)

Learn more about PTMs related to NARF Antibody (NBP2-55660).

Blogs on NARF

There are no specific blogs for NARF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Yongkang Yang
03/17/2021
Application: IF
Species: Human

Yongkang Yang
08/16/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol NARF