Doppel Antibody

Images

 
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining of human endometrium shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Doppel Antibody [NBP2-31928] - Staining in human testis and endometrium tissues using anti-PRND antibody. Corresponding PRND RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Doppel Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQF
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRND
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Doppel Protein (NBP2-31928PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Doppel Antibody

  • dJ1068H6.4
  • DOPPEL
  • DPLprion gene complex, downstream
  • MGC41841
  • prion protein 2 (dublet)
  • Prion protein 2
  • PrPLPprion-like protein doppel

Background

The Doppel gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored g

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Doppel Antibody (NBP2-31928) (0)

There are no publications for Doppel Antibody (NBP2-31928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Doppel Antibody (NBP2-31928) (0)

There are no reviews for Doppel Antibody (NBP2-31928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Doppel Antibody (NBP2-31928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Doppel Products

Research Areas for Doppel Antibody (NBP2-31928)

Find related products by research area.

Blogs on Doppel

There are no specific blogs for Doppel, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Doppel Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRND
Uniprot