Doppel Antibody

Images

 
Immunohistochemistry: Doppel Antibody [NBP2-31928] - Staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Doppel Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRND
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Doppel Protein (NBP2-31928PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Doppel Antibody

  • dJ1068H6.4
  • DOPPEL
  • DPLprion gene complex, downstream
  • MGC41841
  • prion protein 2 (dublet)
  • Prion protein 2
  • PrPLPprion-like protein doppel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-16429
Species: Hu
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-92431
Species: Hu
Applications: WB, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-93533
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31323
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Doppel Antibody (NBP2-31928) (0)

There are no publications for Doppel Antibody (NBP2-31928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Doppel Antibody (NBP2-31928) (0)

There are no reviews for Doppel Antibody (NBP2-31928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Doppel Antibody (NBP2-31928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Doppel Products

Doppel NBP2-31928

Bioinformatics Tool for Doppel Antibody (NBP2-31928)

Discover related pathways, diseases and genes to Doppel Antibody (NBP2-31928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Doppel Antibody (NBP2-31928)

Discover more about diseases related to Doppel Antibody (NBP2-31928).
 

Pathways for Doppel Antibody (NBP2-31928)

View related products by pathway.

PTMs for Doppel Antibody (NBP2-31928)

Learn more about PTMs related to Doppel Antibody (NBP2-31928).

Blogs on Doppel

There are no specific blogs for Doppel, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Doppel Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRND
Uniprot