NAPRT1 Antibody

Images

 
Western Blot: NAPRT1 Antibody [NBP1-87244] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-374
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, ChHa, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAPRT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAPRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
NAPRT1 Protein (NBP1-87244PEP)
Publications
Read Publication using
NBP1-87244 in the following applications:

  • WB
    1 publication

Reactivity Notes

Chinese Hamster, Mouse, Human reactivity reported in scientific literature (PMID: 24204194).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAPRT1 Antibody

  • EC 2.4.2.11
  • FHA-HIT-interacting protein
  • FHIP
  • NAPRTase
  • nicotinate phosphoribosyltransferase domain containing 1
  • Nicotinate phosphoribosyltransferase domain-containing protein 1
  • nicotinate phosphoribosyltransferase
  • nicotinic acid phosphoribosyltransferase
  • PP3856

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02860
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45995
Species: Hu
Applications: WB, IHC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-30636
Species: Hu
Applications: WB, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-55125
Species: Hu
Applications: WB, ICC/IF
NBP2-25143
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF

Publications for NAPRT1 Antibody (NBP1-87244)(1)

We have publications tested in 3 confirmed species: Human, Mouse, Chinese Hamster.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Chinese Hamster
(1)
All Species

Reviews for NAPRT1 Antibody (NBP1-87244) (0)

There are no reviews for NAPRT1 Antibody (NBP1-87244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAPRT1 Antibody (NBP1-87244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAPRT1 Products

Bioinformatics Tool for NAPRT1 Antibody (NBP1-87244)

Discover related pathways, diseases and genes to NAPRT1 Antibody (NBP1-87244). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAPRT1 Antibody (NBP1-87244)

Discover more about diseases related to NAPRT1 Antibody (NBP1-87244).
 

Pathways for NAPRT1 Antibody (NBP1-87244)

View related products by pathway.

Blogs on NAPRT1

There are no specific blogs for NAPRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAPRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAPRT1
Entrez
Uniprot