alcohol dehydrogenase 5 Antibody

Images

 
Western Blot: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in control (vector only transfected HEK293T lysate) and ADH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human skeletal muscle shows low positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Analysis in human endometrium and skeletal muscle tissues. Corresponding ADH5 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-49350] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

alcohol dehydrogenase 5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADH5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Validated in Simple Western (PMID: 32026202)
Control Peptide
alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP)
Publications
Read Publication using
NBP2-49350 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alcohol dehydrogenase 5 Antibody

  • ADH-3
  • ADHXEC 1.1.1.1
  • alcohol dehydrogenase (class III), chi polypeptide
  • alcohol dehydrogenase 5 (class III), chi polypeptide
  • Alcohol dehydrogenase 5
  • Alcohol dehydrogenase class chi chain
  • alcohol dehydrogenase class-3
  • Alcohol dehydrogenase class-III
  • EC 1.1.1
  • EC 1.1.1.-
  • EC 1.1.1.284
  • FALDH
  • FDHGSNOR
  • formaldehyde dehydrogenase
  • Glutathione-dependent formaldehyde dehydrogenase
  • GSH-FDH
  • S-(hydroxymethyl)glutathione dehydrogenase

Background

The ADH5 gene encodes glutathione dependent formaldehyde dehydrogenase or class III alcohol dehydrogenase chi subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, retinol, ethanol and other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class III alcohol dehydrogenase is a homodimer composed of 2 chi subunits. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long chain primary alcohols and for oxidation of S hydroxymethyl glutathione, a spontaneous adduct between formaldehyde and glutathione. The enzyme is an important component of cellular metabolism for the elimination of formaldehyde, which is a potent irritant and sensitizing agent that causes rhinitis, lacrymation, contact dermatitis and pharyngitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-01017
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-92824
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-50033
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-90233
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB300-956
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-90232
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-16374
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF1936
Species: Hu
Applications: IP, WB
NBP2-62658
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-49350
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for alcohol dehydrogenase 5 Antibody (NBP2-49350)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: Simple Western.


Filter By Application
Simple Western
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for alcohol dehydrogenase 5 Antibody (NBP2-49350) (0)

There are no reviews for alcohol dehydrogenase 5 Antibody (NBP2-49350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 5 Antibody (NBP2-49350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alcohol dehydrogenase 5 Products

Diseases for alcohol dehydrogenase 5 Antibody (NBP2-49350)

Discover more about diseases related to alcohol dehydrogenase 5 Antibody (NBP2-49350).
 

Pathways for alcohol dehydrogenase 5 Antibody (NBP2-49350)

View related products by pathway.

PTMs for alcohol dehydrogenase 5 Antibody (NBP2-49350)

Learn more about PTMs related to alcohol dehydrogenase 5 Antibody (NBP2-49350).
 

Research Areas for alcohol dehydrogenase 5 Antibody (NBP2-49350)

Find related products by research area.

Blogs on alcohol dehydrogenase 5

There are no specific blogs for alcohol dehydrogenase 5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH5