Asparagine synthetase Antibody

Images

 
Immunohistochemistry-Paraffin: ASNSD1 Antibody [NBP1-87444] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Asparagine synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASNS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Asparagine synthetase Recombinant Protein Antigen (NBP1-87444PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Asparagine synthetase Antibody

  • asparagine synthetase (glutamine-hydrolyzing)
  • asparagine synthetase [glutamine-hydrolyzing]
  • asparagine synthetase
  • Cell cycle control protein TS11
  • EC 6.3.5.4
  • Glutamine-dependent asparagine synthetase
  • TS11 cell cycle control protein
  • TS11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55125
Species: Hu
Applications: WB, ICC/IF
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Asparagine synthetase Antibody (NBP1-87444) (0)

There are no publications for Asparagine synthetase Antibody (NBP1-87444).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Asparagine synthetase Antibody (NBP1-87444) (0)

There are no reviews for Asparagine synthetase Antibody (NBP1-87444). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Asparagine synthetase Antibody (NBP1-87444) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Asparagine synthetase Products

Bioinformatics Tool for Asparagine synthetase Antibody (NBP1-87444)

Discover related pathways, diseases and genes to Asparagine synthetase Antibody (NBP1-87444). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Asparagine synthetase Antibody (NBP1-87444)

Discover more about diseases related to Asparagine synthetase Antibody (NBP1-87444).
 

Pathways for Asparagine synthetase Antibody (NBP1-87444)

View related products by pathway.

PTMs for Asparagine synthetase Antibody (NBP1-87444)

Learn more about PTMs related to Asparagine synthetase Antibody (NBP1-87444).

Blogs on Asparagine synthetase

There are no specific blogs for Asparagine synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Asparagine synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASNS