NAPRT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Analysis in human small intestine and skeletal muscle tissues using NBP1-87243 antibody. Corresponding NAPRT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Staining of human colon, kidney, lymph node and urinary bladder using Anti-NAPRT antibody NBP1-87243 (A) shows similar protein distribution across tissues to independent antibody NBP1-87244 (B).

Western Blot: NAPRT1 Antibody [NBP1-87243] - Analysis using Anti-NAPRT antibody NBP1-87243 (A) shows similar pattern to independent antibody NBP1-87244 (B).

Immunocytochemistry/Immunofluorescence: NAPRT1 Antibody [NBP1-87243] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87243] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NAPRT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NAPRT1 Antibody - BSA Free (NBP1-87243) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-NAPRT1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAPRT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation Reported in scientific literature (PMID:31511522).
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NAPRT1 Protein (NBP1-87243PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NAPRT1 Antibody - BSA Free

• EC 2.4.2.11
• FHA-HIT-interacting protein
• FHIP
• NAPRTase
• nicotinate phosphoribosyltransferase domain containing 1
• Nicotinate phosphoribosyltransferase domain-containing protein 1
• nicotinate phosphoribosyltransferase
• nicotinic acid phosphoribosyltransferase
• PP3856

Background

Nicotinic acid (NA; niacin) is converted by nicotinic acid phosphoribosyltransferase (NAPRT; EC 2.4.2.11) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD), which serves as a coenzyme in cellular redox reactions and is an essential component of a variety of processes in cellular metabolism including response to stress (Hara et al., 2007).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NAPRT1 Antibody (NBP1-87243)(6)

Publications using NBP1-87243

• Kim M, Kim H, Kang BG et al. Discovery of a novel NAMPT inhibitor that selectively targets NAPRT-deficient EMT-subtype cancer cells and alleviates chemotherapy-induced peripheral neuropathy Theranostics 2023-09-11 [PMID: 37771778]
• Manago A, Audrito V, Mazzola F et al. Extracellular nicotinate phosphoribosyltransferase binds Toll like receptor 4 and mediates inflammation Nat Commun 2019-09-11 [PMID: 31511522] (WB, IP, ICC/IF, Human)
• Gaudino F, Manfredonia I, Manago A et al. Subcellular characterization of NAD+ biosynthesis in metastatic melanoma by using organelle-specific biosensors Antioxid. Redox Signal. 2019-08-28 [PMID: 31456414]
• Lee J, Kim H et al. Selective Cytotoxicity of the NAMPT Inhibitor FK866 Toward Gastric Cancer Cells With Markers of the Epithelial-Mesenchymal Transition, Due to Loss of NAPRT. Gastroenterology 2018-01-09 [PMID: 29775598] (IF/IHC, Human)
• Shames DS, Elkins K, Walter K et al. Loss of NAPRT1 Expression by Tumor-Specific Promoter Methylation Provides a Novel Predictive Biomarker for NAMPT Inhibitors. Clin Cancer Res 2013-12-15 [PMID: 24097869] (IHC-P, Human)
• Fagerberg L, Stadler C, Skogs M et al. Mapping the subcellular protein distribution in three human cell lines. J Proteome Res 2011-08-01 [PMID: 21675716]

Bioinformatics

• Gene Symbol: NAPRT
• Entrez:
  • 93100(Human)
• Uniprot:
  • Q6XQN6(Human)